Recombinant Human FCGRT protein, Myc/DDK-tagged
Cat.No. : | FCGRT-01H |
Product Overview : | Recombinant Human FCGRT protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Transmembrane. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC427768 RC227329 |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name | FCGRT Fc gamma receptor and transporter [ Homo sapiens (human) ] |
Official Symbol | FCGRT |
Synonyms | alpha-chain; FCRN |
Gene ID | 2217 |
mRNA Refseq | NM_001136019 |
Protein Refseq | NP_001129491 |
MIM | 601437 |
UniProt ID | P55899 |
◆ Recombinant Proteins | ||
FCGRT-2760H | Recombinant Human FCGRT Protein (Met1-Ser297), C-His tagged | +Inquiry |
Fcgrt-491M | Active Recombinant Mouse Fc Receptor, LgG, Alpha Chain Transporter, His-tagged | +Inquiry |
FCGRT-2306R | Recombinant Rat FCGRT Protein | +Inquiry |
FCGRT-902H | Recombinant Human FCGRT Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGRT-01H | Recombinant Human FCGRT protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *