Recombinant Human FCGRT protein, Myc/DDK-tagged
| Cat.No. : | FCGRT-01H |
| Product Overview : | Recombinant Human FCGRT protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Transmembrane. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. |
| Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | myc-FLAG tag |
| Product-Related Proteins : | TA50011-100 LC427768 RC227329 |
| Purity : | > 80% |
| Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL |
| Gene Name | FCGRT Fc gamma receptor and transporter [ Homo sapiens (human) ] |
| Official Symbol | FCGRT |
| Synonyms | alpha-chain; FCRN |
| Gene ID | 2217 |
| mRNA Refseq | NM_001136019 |
| Protein Refseq | NP_001129491 |
| MIM | 601437 |
| UniProt ID | P55899 |
| ◆ Recombinant Proteins | ||
| FCGRT-33H | Recombinant Human FCGRT Protein, Ala24-Ser297, C-6×His tagged | +Inquiry |
| FCGRT-01H | Recombinant Human FCGRT protein, Myc/DDK-tagged | +Inquiry |
| FCGRT-7513R | Recombinant Rat FCGRT, His tagged | +Inquiry |
| FCGRT-3802H | Recombinant Human FCGRT, His tagged | +Inquiry |
| FCGRT-376H | Recombinant Human FCGRT Protein, AVI-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGRT Products
Required fields are marked with *
My Review for All FCGRT Products
Required fields are marked with *
