Recombinant Human FCN3 protein, His-tagged

• Cat.No.: FCN3-2893H
• Product Overview: Recombinant Human FCN3 protein(O75636)(24-299aa), fused to C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 24-299aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.8 kDa
• AA Sequence: QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: FCN3 ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) [ Homo sapiens ]
• Official Symbol: FCN3
• Synonyms: FCN3; ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen); ficolin-3; FCNH; HAKA1; H-ficolin; ficolin 3; collagen/fibrinogen domain-containing protein 3; collagen/fibrinogen domain-containing lectin 3 p35; MGC22543
• Gene ID: 8547
• mRNA Refseq: NM_003665
• Protein Refseq: NP_003656
• MIM: 604973
• UniProt ID: O75636