Recombinant Human FCN3 protein, His-tagged

Cat.No. : FCN3-2893H
Product Overview : Recombinant Human FCN3 protein(O75636)(24-299aa), fused to C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24-299aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 34.8 kDa
AA Sequence : QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name FCN3 ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) [ Homo sapiens ]
Official Symbol FCN3
Synonyms FCN3; ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen); ficolin-3; FCNH; HAKA1; H-ficolin; ficolin 3; collagen/fibrinogen domain-containing protein 3; collagen/fibrinogen domain-containing lectin 3 p35; MGC22543;
Gene ID 8547
mRNA Refseq NM_003665
Protein Refseq NP_003656
MIM 604973
UniProt ID O75636

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCN3 Products

Required fields are marked with *

My Review for All FCN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon