Recombinant Human FCN3 protein, His-tagged
Cat.No. : | FCN3-2893H |
Product Overview : | Recombinant Human FCN3 protein(O75636)(24-299aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-299aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.8 kDa |
AA Sequence : | QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FCN3 ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) [ Homo sapiens ] |
Official Symbol | FCN3 |
Synonyms | FCN3; ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen); ficolin-3; FCNH; HAKA1; H-ficolin; ficolin 3; collagen/fibrinogen domain-containing protein 3; collagen/fibrinogen domain-containing lectin 3 p35; MGC22543; |
Gene ID | 8547 |
mRNA Refseq | NM_003665 |
Protein Refseq | NP_003656 |
MIM | 604973 |
UniProt ID | O75636 |
◆ Recombinant Proteins | ||
FCN3-2893H | Recombinant Human FCN3 protein, His-tagged | +Inquiry |
FCN3-2937H | Recombinant Human FCN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCN3-4004H | Recombinant Human FCN3 Protein, GST-tagged | +Inquiry |
FCN3-854H | Active Recombinant Human FCN3 Protein, His-tagged | +Inquiry |
FCN3-12827H | Recombinant Human FCN3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCN3-614HCL | Recombinant Human FCN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCN3 Products
Required fields are marked with *
My Review for All FCN3 Products
Required fields are marked with *
0
Inquiry Basket