Recombinant Human FCRL2 Protein, GST-tagged

Cat.No. : FCRL2-4008H
Product Overview : Human FCRL2 partial ORF ( NP_110391, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Apr 2009]
Molecular Mass : 37.84 kDa
AA Sequence : MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FCRL2 Fc receptor-like 2 [ Homo sapiens ]
Official Symbol FCRL2
Synonyms FCRL2; Fc receptor-like 2; SH2 domain containing phosphatase anchor protein 1 , SPAP1; Fc receptor-like protein 2; CD307b; FCRH2; IRTA4; fcR-like protein 2; IFGP family protein 4; fc receptor homolog 2; immunoglobulin superfamily Fc receptor, gp42; SH2 domain containing phosphatase anchor protein 1; SH2 domain-containing phosphatase anchor protein 1; immune receptor translocation-associated protein 4; immunoglobulin receptor translocation-associated protein 4; IFGP4; SPAP1; SPAP1A; SPAP1B; SPAP1C;
Gene ID 79368
mRNA Refseq NM_030764
Protein Refseq NP_110391
MIM 606509
UniProt ID Q96LA5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCRL2 Products

Required fields are marked with *

My Review for All FCRL2 Products

Required fields are marked with *

0
cart-icon