Recombinant Human FCRL5 protein, His-tagged

• Cat.No.: FCRL5-12831H
• Product Overview: Recombinant Human FCRL5 protein(245-375 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 245-375 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: FQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: FCRL5 Fc receptor-like 5 [ Homo sapiens ]
• Official Symbol: FCRL5
• Synonyms: FCRL5; Fc receptor-like 5; Fc receptor-like protein 5; BXMAS1; CD307e; FCRH5; IRTA2; fcR-like protein 5; fc receptor homolog 5; immune receptor translocation-associated protein 2; immunoglobulin superfamily receptor translocation associated 2 (IRTA2); CD307; PRO820; FLJ00333; FLJ00397; RP11-217A12.1; MGC119590; MGC119592; MGC119593; DKFZp667F216; DKFZp667E2019
• Gene ID: 83416
• mRNA Refseq: NM_001195388
• Protein Refseq: NP_001182317
• MIM: 605877
• UniProt ID: Q96RD9