Recombinant Human FCRL5 protein, His-tagged

Cat.No. : FCRL5-12831H
Product Overview : Recombinant Human FCRL5 protein(245-375 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability July 28, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 245-375 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : FQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTV
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name FCRL5 Fc receptor-like 5 [ Homo sapiens ]
Official Symbol FCRL5
Synonyms FCRL5; Fc receptor-like 5; Fc receptor-like protein 5; BXMAS1; CD307e; FCRH5; IRTA2; fcR-like protein 5; fc receptor homolog 5; immune receptor translocation-associated protein 2; immunoglobulin superfamily receptor translocation associated 2 (IRTA2); CD307; PRO820; FLJ00333; FLJ00397; RP11-217A12.1; MGC119590; MGC119592; MGC119593; DKFZp667F216; DKFZp667E2019;
Gene ID 83416
mRNA Refseq NM_001195388
Protein Refseq NP_001182317
MIM 605877
UniProt ID Q96RD9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCRL5 Products

Required fields are marked with *

My Review for All FCRL5 Products

Required fields are marked with *

0
cart-icon
0
compare icon