Recombinant Human FDX1 protein, His&Myc-tagged
| Cat.No. : | FDX1-633H |
| Product Overview : | Recombinant Human FDX1 protein(P10109)(61-184aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 61-184a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS |
| Gene Name | FDX1 ferredoxin 1 [ Homo sapiens ] |
| Official Symbol | FDX1 |
| Synonyms | FDX1; ferredoxin 1; FDX; adrenodoxin, mitochondrial; adrenodoxin; ADX; ferredoxin-1; hepatoredoxin; adrenal ferredoxin; mitochondrial adrenodoxin; LOH11CR1D; |
| Gene ID | 2230 |
| mRNA Refseq | NM_004109 |
| Protein Refseq | NP_004100 |
| MIM | 103260 |
| UniProt ID | P10109 |
| ◆ Recombinant Proteins | ||
| Fdx1-2981M | Recombinant Mouse Fdx1 Protein, Myc/DDK-tagged | +Inquiry |
| FDX1-12835H | Recombinant Human FDX1, GST-tagged | +Inquiry |
| FDX1-2624B | Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged | +Inquiry |
| Fdx1-3225R | Recombinant Rat Fdx1, His-tagged | +Inquiry |
| FDX1-4341H | Recombinant Human FDX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FDX1-6270HCL | Recombinant Human FDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDX1 Products
Required fields are marked with *
My Review for All FDX1 Products
Required fields are marked with *




