Recombinant Human FDX1 protein, His&Myc-tagged
Cat.No. : | FDX1-633H |
Product Overview : | Recombinant Human FDX1 protein(P10109)(61-184aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 61-184a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS |
Gene Name | FDX1 ferredoxin 1 [ Homo sapiens ] |
Official Symbol | FDX1 |
Synonyms | FDX1; ferredoxin 1; FDX; adrenodoxin, mitochondrial; adrenodoxin; ADX; ferredoxin-1; hepatoredoxin; adrenal ferredoxin; mitochondrial adrenodoxin; LOH11CR1D; |
Gene ID | 2230 |
mRNA Refseq | NM_004109 |
Protein Refseq | NP_004100 |
MIM | 103260 |
UniProt ID | P10109 |
◆ Recombinant Proteins | ||
FDX1-633H | Recombinant Human FDX1 protein, His&Myc-tagged | +Inquiry |
FDX1-2645B | Recombinant Bovine FDX1 Protein (59-186 aa), His-tagged | +Inquiry |
FDX1-2896B | Recombinant Bovine FDX1 protein, His-tagged | +Inquiry |
FDX1-3203M | Recombinant Mouse FDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FDX1-483H | Recombinant Human Ferredoxin 1, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FDX1-6270HCL | Recombinant Human FDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FDX1 Products
Required fields are marked with *
My Review for All FDX1 Products
Required fields are marked with *