Recombinant Human FECH protein, His-tagged
| Cat.No. : | FECH-12837H |
| Product Overview : | Recombinant Human FECH protein(60-423 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 60-423 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | VQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FECH ferrochelatase [ Homo sapiens ] |
| Official Symbol | FECH |
| Synonyms | FECH; ferrochelatase; ferrochelatase (protoporphyria); ferrochelatase, mitochondrial; protoporphyria; heme synthase; heme synthetase; protoheme ferro-lyase; EPP; FCE; |
| Gene ID | 2235 |
| mRNA Refseq | NM_000140 |
| Protein Refseq | NP_000131 |
| MIM | 612386 |
| UniProt ID | P22830 |
| ◆ Recombinant Proteins | ||
| FECH-1007H | Recombinant Human FECH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FECH-01H | Recombinant human FECH protein, C-Myc/DDK-tagged | +Inquiry |
| FECH-2604H | Recombinant Human FECH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FECH-2943H | Recombinant Human FECH Protein, His (Fc)-Avi-tagged | +Inquiry |
| FECH-12837H | Recombinant Human FECH protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FECH Products
Required fields are marked with *
My Review for All FECH Products
Required fields are marked with *
