Recombinant Human FGF1 Protein, GST-tagged
| Cat.No. : | FGF1-4094H |
| Product Overview : | Human FGF1 full-length ORF ( NP_000791.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq |
| Molecular Mass : | 43.9 kDa |
| AA Sequence : | MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
| Official Symbol | FGF1 |
| Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
| Gene ID | 2246 |
| mRNA Refseq | NM_000800 |
| Protein Refseq | NP_000791 |
| MIM | 131220 |
| UniProt ID | P05230 |
| ◆ Recombinant Proteins | ||
| FGF1-630P | Recombinant Pig FGF1 protein, His & GST-tagged | +Inquiry |
| Fgf1-7205M | Active Recombinant Mouse FGF1 protein, His-tagged | +Inquiry |
| FGF1-11H | Active Recombinant Human FGF1 Protein (Carrier-Ready-To-Use, 140 amino acid) | +Inquiry |
| FGF1-1692R | Recombinant Rhesus monkey FGF1 Protein, His-tagged | +Inquiry |
| FGF1-2528H | Recombinant Human FGF1 Protein (Phe16-Asp155) | +Inquiry |
| ◆ Native Proteins | ||
| FGF1-26203TH | Native Human FGF1 | +Inquiry |
| FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *



