Recombinant Mouse Fgf1 Protein, His-tagged

Cat.No. : Fgf1-7205M
Product Overview : Recombinant Mouse Fgf1 protein with a His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 16-155
Description : Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1. Can induce angiogenesis.
Form : Liquid
AA Sequence : MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 %
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 0.1 M NaCl
Gene Name Fgf1 fibroblast growth factor 1 [ Mus musculus (house mouse) ]
Official Symbol Fgf1
Synonyms Fgf1; fibroblast growth factor 1; Fam; Fgf; Fgfa; Dffrx; Fgf-1; Fgf2b; fibroblast growth factor 1; HBGF-1; aFGF; acidic fibroblast growth factor; fibroblast growth factor 1 (acidic); fibroblast growth factor 2b; heparin-binding growth factor 1
Gene ID 14164
mRNA Refseq NM_010197
Protein Refseq NP_034327
UniProt ID P61148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf1 Products

Required fields are marked with *

My Review for All Fgf1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon