Recombinant Mouse Fgf1 Protein, His-tagged
Cat.No. : | Fgf1-7205M |
Product Overview : | Recombinant Mouse Fgf1 protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 16-155 |
Description : | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1. Can induce angiogenesis. |
Form : | Liquid |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 0.1 M NaCl |
Gene Name | Fgf1 fibroblast growth factor 1 [ Mus musculus (house mouse) ] |
Official Symbol | Fgf1 |
Synonyms | Fgf1; fibroblast growth factor 1; Fam; Fgf; Fgfa; Dffrx; Fgf-1; Fgf2b; fibroblast growth factor 1; HBGF-1; aFGF; acidic fibroblast growth factor; fibroblast growth factor 1 (acidic); fibroblast growth factor 2b; heparin-binding growth factor 1 |
Gene ID | 14164 |
mRNA Refseq | NM_010197 |
Protein Refseq | NP_034327 |
UniProt ID | P61148 |
◆ Recombinant Proteins | ||
FGF1-79M | Recombinant Mouse/Rat FGF1 Protein | +Inquiry |
FGF1-6735C | Recombinant Chicken FGF1 | +Inquiry |
FGF1-2528H | Recombinant Human FGF1 Protein (Phe16-Asp155) | +Inquiry |
Fgf1-057M | Active Recombinant Mouse Fgf1 Protein | +Inquiry |
FGF1-199H | Recombinant Human Acidic Fibroblast Growth Factor, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf1 Products
Required fields are marked with *
My Review for All Fgf1 Products
Required fields are marked with *
0
Inquiry Basket