Recombinant Human FGF10 protein, His-SUMO-tagged
| Cat.No. : | FGF10-2905H |
| Product Overview : | Recombinant Human FGF10 protein(O15520)(37-208aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 37-208aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.4 kDa |
| AA Sequence : | CQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FGF10 fibroblast growth factor 10 [ Homo sapiens ] |
| Official Symbol | FGF10 |
| Synonyms | FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; |
| Gene ID | 2255 |
| mRNA Refseq | NM_004465 |
| Protein Refseq | NP_004456 |
| MIM | 602115 |
| UniProt ID | O15520 |
| ◆ Recombinant Proteins | ||
| FGF10-05H | Recombinant Human/Rat/Bovine/Porcine FGF10 Protein | +Inquiry |
| FGF10-559H | Human Protein FGF10 PDB 1nun | +Inquiry |
| FGF10-102H | Active Recombinant Human FGF10 Protein (Leu40-Ser208), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| FGF10-11HG | Active GMP Recombinant Human FGF10 Protein, Fc-tagged | +Inquiry |
| Fgf10-1927R | Recombinant Rat Fgf10 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
