Recombinant Human FGF13

• Cat.No.: FGF13-27598TH
• Product Overview: Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 245 amino acids
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini.
• Molecular Weight: 52.690kDa inclusive of tags
• Tissue specificity: Nervous system.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST
• Sequence Similarities: Belongs to the heparin-binding growth factors family.

Gene Information

• Gene Name: FGF13 fibroblast growth factor 13 [ Homo sapiens ]
• Official Symbol: FGF13
• Synonyms: FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2
• Gene ID: 2258
• mRNA Refseq: NM_001139498
• Protein Refseq: NP_001132970
• MIM: 300070
• Uniprot ID: Q92913
• Chromosome Location: Xq26.3
• Pathway: MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; Melanoma, organism-specific biosystem; Melanoma, conserved biosystem; Pathways in cancer, organism-specific biosystem
• Function: growth factor activity; protein kinase activator activity