Recombinant Human FGF13

Cat.No. : FGF13-27598TH
Product Overview : Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 245 amino acids
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini.
Molecular Weight : 52.690kDa inclusive of tags
Tissue specificity : Nervous system.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST
Sequence Similarities : Belongs to the heparin-binding growth factors family.
Gene Name FGF13 fibroblast growth factor 13 [ Homo sapiens ]
Official Symbol FGF13
Synonyms FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2;
Gene ID 2258
mRNA Refseq NM_001139498
Protein Refseq NP_001132970
MIM 300070
Uniprot ID Q92913
Chromosome Location Xq26.3
Pathway MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; Melanoma, organism-specific biosystem; Melanoma, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function growth factor activity; protein kinase activator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF13 Products

Required fields are marked with *

My Review for All FGF13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon