Recombinant Human FGF13
Cat.No. : | FGF13-27598TH |
Product Overview : | Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 245 amino acids |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini. |
Molecular Weight : | 52.690kDa inclusive of tags |
Tissue specificity : | Nervous system. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST |
Sequence Similarities : | Belongs to the heparin-binding growth factors family. |
Gene Name | FGF13 fibroblast growth factor 13 [ Homo sapiens ] |
Official Symbol | FGF13 |
Synonyms | FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2; |
Gene ID | 2258 |
mRNA Refseq | NM_001139498 |
Protein Refseq | NP_001132970 |
MIM | 300070 |
Uniprot ID | Q92913 |
Chromosome Location | Xq26.3 |
Pathway | MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; Melanoma, organism-specific biosystem; Melanoma, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function | growth factor activity; protein kinase activator activity; |
◆ Recombinant Proteins | ||
FGF13-2326R | Recombinant Rat FGF13 Protein | +Inquiry |
FGF13-1695R | Recombinant Rhesus monkey FGF13 Protein, His-tagged | +Inquiry |
FGF13-1139C | Recombinant Chicken FGF13 | +Inquiry |
FGF13-3100HFL | Recombinant Full Length Human FGF13 Protein, Flag-tagged | +Inquiry |
Fgf13-5147M | Recombinant Mouse Fgf13 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF13-6248HCL | Recombinant Human FGF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF13 Products
Required fields are marked with *
My Review for All FGF13 Products
Required fields are marked with *