Recombinant Human FGF16 protein

Cat.No. : FGF16-168H
Product Overview : Recombinant Human FGF16 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 206
Description : Fibroblast growth factor 16 (FGF-16) belongs to the large FGF family. All FGF family members are heparin-binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-16 was originally identified in rat heart tissue by homology based polymerase chain reaction. Human FGF-16 cDNA predicts a 207 aa precursor protein with one N-linked glycosylation site. FGF-16 lacks a typical signal peptide, but is efficiently generated by mechanisms other than the classical protein secretion pathway. Among FGF family members, FGF-16 is most similar to FGF-9, sharing 73% aa sequence homology. Human FGF-16 shares 99% and 98.6% aa sequence identity with the mouse and rat FGF-16, respectively.
Form : Supplied as a 0.2μm filtered solution in 20 mM Tris-HCl, 1 M NaCl, pH 9.0, with 0.02 % Tween-20, 10 % Glycerol.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 23.6 kDa, a single non-glycosylated polypeptide chain containing 206 amino acids.
AA Sequence : AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Endotoxin : Less than 0.1 EU/µg of rHuFGF-16 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Gene Name FGF16
Official Symbol FGF16
Synonyms FGF16; fibroblast growth factor 16; FGF-16;
Gene ID 8823
mRNA Refseq NM_003868
Protein Refseq NP_003859
MIM 300827
UniProt ID O43320

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF16 Products

Required fields are marked with *

My Review for All FGF16 Products

Required fields are marked with *

0
cart-icon