Recombinant Human FGF3 protein, His&Myc-tagged

• Cat.No.: FGF3-7543H
• Product Overview: Recombinant Human FGF3 protein(P11487)(18-239aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 18-239a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH

Gene Information

• Gene Name: FGF3 fibroblast growth factor 3 [ Homo sapiens ]
• Official Symbol: FGF3
• Synonyms: FGF3; fibroblast growth factor 3; fibroblast growth factor 3 (murine mammary tumor virus integration site (v int 2) oncogene homolog) , INT2; HBGF 3; INT 2 proto oncogene protein; murine mammary tumor virus integration site 2; mouse; oncogene INT2; V INT2 murine mammary tumor virus integration site oncogene homolog; FGF-3; proto-oncogene Int-2; INT-2 proto-oncogene protein; heparin-binding growth factor 3; murine mammary tumor virus integration site 2, mouse; V-INT2 murine mammary tumor virus integration site oncogene homolog; fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog); INT2; HBGF-3
• Gene ID: 2248
• mRNA Refseq: NM_005247
• Protein Refseq: NP_005238
• MIM: 164950
• UniProt ID: P11487