Recombinant Human FGF3 protein, His&Myc-tagged

Cat.No. : FGF3-7543H
Product Overview : Recombinant Human FGF3 protein(P11487)(18-239aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 18-239a.a.
Tag : His&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.4 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Gene Name FGF3 fibroblast growth factor 3 [ Homo sapiens ]
Official Symbol FGF3
Synonyms FGF3; fibroblast growth factor 3; fibroblast growth factor 3 (murine mammary tumor virus integration site (v int 2) oncogene homolog) , INT2; HBGF 3; INT 2 proto oncogene protein; murine mammary tumor virus integration site 2; mouse; oncogene INT2; V INT2 murine mammary tumor virus integration site oncogene homolog; FGF-3; proto-oncogene Int-2; INT-2 proto-oncogene protein; heparin-binding growth factor 3; murine mammary tumor virus integration site 2, mouse; V-INT2 murine mammary tumor virus integration site oncogene homolog; fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog); INT2; HBGF-3;
Gene ID 2248
mRNA Refseq NM_005247
Protein Refseq NP_005238
MIM 164950
UniProt ID P11487

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF3 Products

Required fields are marked with *

My Review for All FGF3 Products

Required fields are marked with *

0
cart-icon
0
compare icon