Recombinant Human FGFBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FGFBP2-5684H
Product Overview : FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
Molecular Mass : 24.6 kDa
AA Sequence : MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens (human) ]
Official Symbol FGFBP2
Synonyms FGFBP2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; killer specific secretory protein of 37 kDa; KSP37; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa; HBP17RP;
Gene ID 83888
mRNA Refseq NM_031950
Protein Refseq NP_114156
MIM 607713
UniProt ID Q9BYJ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFBP2 Products

Required fields are marked with *

My Review for All FGFBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon