Recombinant Human FGFBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FGFBP2-5684H |
| Product Overview : | FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma. |
| Molecular Mass : | 24.6 kDa |
| AA Sequence : | MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens (human) ] |
| Official Symbol | FGFBP2 |
| Synonyms | FGFBP2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; killer specific secretory protein of 37 kDa; KSP37; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa; HBP17RP; |
| Gene ID | 83888 |
| mRNA Refseq | NM_031950 |
| Protein Refseq | NP_114156 |
| MIM | 607713 |
| UniProt ID | Q9BYJ0 |
| ◆ Recombinant Proteins | ||
| FGFBP2-909H | Recombinant Human FGFBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGFBP2-115H | Recombinant Human FGFBP2 protein(Met1-Gly223), His-tagged | +Inquiry |
| FGFBP2-1525R | Recombinant Rhesus Macaque FGFBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGFBP2-1703R | Recombinant Rhesus monkey FGFBP2 Protein, His-tagged | +Inquiry |
| FGFBP2-5684H | Recombinant Human FGFBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGFBP2-6232HCL | Recombinant Human FGFBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFBP2 Products
Required fields are marked with *
My Review for All FGFBP2 Products
Required fields are marked with *
