Recombinant Human FGFBP3 Protein, GST-tagged
Cat.No. : | FGFBP3-4120H |
Product Overview : | Human FGFBP3 full-length ORF (BAC11602.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FGFBP3 (Fibroblast Growth Factor Binding Protein 3) is a Protein Coding gene. Among its related pathways are Signaling by FGFR2 and Signaling by GPCR. GO annotations related to this gene include heparin binding and fibroblast growth factor binding. |
Molecular Mass : | 54 kDa |
AA Sequence : | MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNVGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGFBP3 fibroblast growth factor binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | FGFBP3 |
Synonyms | FGFBP3; fibroblast growth factor binding protein 3; FGF-BP3; C10orf13; fibroblast growth factor-binding protein 3; FGF-binding protein 3; FGFBP-3 |
Gene ID | 143282 |
mRNA Refseq | NM_152429 |
Protein Refseq | NP_689642 |
UniProt ID | Q8TAT2 |
◆ Recombinant Proteins | ||
FGFBP3-267H | Recombinant Human FGFBP3 Protein, His-tagged | +Inquiry |
FGFBP3-5859M | Recombinant Mouse FGFBP3 Protein | +Inquiry |
FGFBP3-15H | Recombinant Human FGFBP3 Protein, His-tagged | +Inquiry |
FGFBP3-3240M | Recombinant Mouse FGFBP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGFBP3-4843HF | Recombinant Full Length Human FGFBP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFBP3-421HCL | Recombinant Human FGFBP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFBP3 Products
Required fields are marked with *
My Review for All FGFBP3 Products
Required fields are marked with *