Recombinant Human FGL2 Protein (24-439 aa), His-tagged
Cat.No. : | FGL2-1656H |
Product Overview : | Recombinant Human FGL2 Protein (24-439 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-439 aa |
Description : | May play a role in physiologic lymphocyte functions at mucosal sites |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 49.6 kDa |
AA Sequence : | NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | FGL2 fibrinogen-like 2 [ Homo sapiens ] |
Official Symbol | FGL2 |
Synonyms | FGL2; fibrinogen-like 2; fibroleukin; pT49; T49; |
Gene ID | 10875 |
mRNA Refseq | NM_006682 |
Protein Refseq | NP_006673 |
MIM | 605351 |
UniProt ID | Q14314 |
◆ Recombinant Proteins | ||
FGL2-4944HF | Recombinant Full Length Human FGL2 Protein, GST-tagged | +Inquiry |
FGL2-1656H | Recombinant Human FGL2 Protein (24-439 aa), His-tagged | +Inquiry |
FGL2-12885H | Recombinant Human FGL2 protein, His-tagged | +Inquiry |
FGL2-1352C | Recombinant Cynomolgus FGL2 protein, His-Avi,Flag-tagged, Biotinylated | +Inquiry |
FGL2-1351M | Recombinant Mouse FGL2 protein, His-Avi,Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGL2-622HCL | Recombinant Human FGL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGL2 Products
Required fields are marked with *
My Review for All FGL2 Products
Required fields are marked with *