Recombinant Human FGL2 Protein (24-439 aa), His-tagged
| Cat.No. : | FGL2-1656H |
| Product Overview : | Recombinant Human FGL2 Protein (24-439 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 24-439 aa |
| Description : | May play a role in physiologic lymphocyte functions at mucosal sites |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 49.6 kDa |
| AA Sequence : | NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | FGL2 fibrinogen-like 2 [ Homo sapiens ] |
| Official Symbol | FGL2 |
| Synonyms | FGL2; fibrinogen-like 2; fibroleukin; pT49; T49; |
| Gene ID | 10875 |
| mRNA Refseq | NM_006682 |
| Protein Refseq | NP_006673 |
| MIM | 605351 |
| UniProt ID | Q14314 |
| ◆ Recombinant Proteins | ||
| FGL2-3245M | Recombinant Mouse FGL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGL2-1464H | Recombinant Human FGL2 protein, His-tagged | +Inquiry |
| FGL2-1585H | Recombinant Human FGL2 protein, His-Avi,Flag-tagged | +Inquiry |
| FGL2-1360C | Recombinant Cynomolgus FGL2 protein, His-Avi,Flag-tagged | +Inquiry |
| FGL2-1656H | Recombinant Human FGL2 Protein (24-439 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGL2-622HCL | Recombinant Human FGL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGL2 Products
Required fields are marked with *
My Review for All FGL2 Products
Required fields are marked with *
