Recombinant Human FHL2 Protein, GST-tagged
| Cat.No. : | FHL2-4162H |
| Product Overview : | Human FHL2 full-length ORF ( AAH14397, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | LIM proteins contain a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM |
| Molecular Mass : | 56.43 kDa |
| AA Sequence : | MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FHL2 four and a half LIM domains 2 [ Homo sapiens ] |
| Official Symbol | FHL2 |
| Synonyms | FHL2; four and a half LIM domains 2; four and a half LIM domains protein 2; DRAL; SLIM3; LIM domain protein DRAL; aging-associated gene 11; skeletal muscle LIM-protein 3; four and a half LIM-domain protein 2; down-regulated in rhabdomyosarcoma LIM protein; AAG11; FHL-2; SLIM-3; |
| Gene ID | 2274 |
| mRNA Refseq | NM_001039492 |
| Protein Refseq | NP_001034581 |
| MIM | 602633 |
| UniProt ID | Q14192 |
| ◆ Recombinant Proteins | ||
| FHL2-2001R | Recombinant Rat FHL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FHL2-793H | Recombinant Human FHL2 Protein, His-tagged | +Inquiry |
| FHL2-8954H | Recombinant Human FHL2 protein, His-tagged | +Inquiry |
| FHL2-2345R | Recombinant Rat FHL2 Protein | +Inquiry |
| FHL2-5876M | Recombinant Mouse FHL2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FHL2-6224HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
| FHL2-6223HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FHL2 Products
Required fields are marked with *
My Review for All FHL2 Products
Required fields are marked with *
