Recombinant Human FIBP protein, His-SUMO-tagged
| Cat.No. : | FIBP-2919H |
| Product Overview : | Recombinant Human FIBP protein(O43427)(2-357aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-357aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 57.1 kDa |
| AA Sequence : | TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FIBP fibroblast growth factor (acidic) intracellular binding protein [ Homo sapiens ] |
| Official Symbol | FIBP |
| Synonyms | FIBP; fibroblast growth factor (acidic) intracellular binding protein; acidic fibroblast growth factor intracellular-binding protein; FGFIBP; aFGF intracellular-binding protein; FGF-1 intracellular-binding protein; FIBP-1; |
| Gene ID | 9158 |
| mRNA Refseq | NM_004214 |
| Protein Refseq | NP_004205 |
| MIM | 608296 |
| UniProt ID | O43427 |
| ◆ Recombinant Proteins | ||
| FIBP-3257H | Recombinant Human FIBP Protein (Met1-Asp357) | +Inquiry |
| FIBP-4168H | Recombinant Human FIBP Protein, GST-tagged | +Inquiry |
| FIBP-12893H | Recombinant Human FIBP protein, His-tagged | +Inquiry |
| FIBP-7822H | Recombinant Human FIBP protein, GST-tagged | +Inquiry |
| FIBP-4980HF | Recombinant Full Length Human FIBP Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIBP Products
Required fields are marked with *
My Review for All FIBP Products
Required fields are marked with *
