Recombinant Human FIGF protein, GST-tagged
Cat.No. : | FIGF-301286H |
Product Overview : | Recombinant Human FIGF protein(90-128 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 90-128 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKST |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | FIGF c-fos induced growth factor (vascular endothelial growth factor D) [ Homo sapiens ] |
Official Symbol | FIGF |
Synonyms | FIGF; c-fos induced growth factor (vascular endothelial growth factor D); VEGFD; vascular endothelial growth factor D; VEGF D; VEGF-D; |
mRNA Refseq | NM_004469 |
Protein Refseq | NP_004460 |
MIM | 300091 |
UniProt ID | O43915 |
Gene ID | 2277 |
◆ Recombinant Proteins | ||
FIGF-2005R | Recombinant Rat FIGF Protein, His (Fc)-Avi-tagged | +Inquiry |
FIGF-3727Z | Recombinant Zebrafish FIGF | +Inquiry |
FIGF-212H | Recombinant Human FIGF, His tagged | +Inquiry |
FIGF-2349R | Recombinant Rat FIGF Protein | +Inquiry |
FIGF-4170H | Recombinant Human FIGF Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FIGF-2767HCL | Recombinant Human FIGF cell lysate | +Inquiry |
FIGF-1312MCL | Recombinant Mouse FIGF cell lysate | +Inquiry |
FIGF-1265RCL | Recombinant Rat FIGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FIGF Products
Required fields are marked with *
My Review for All FIGF Products
Required fields are marked with *