Recombinant Human FIGF protein, GST-tagged

• Cat.No.: FIGF-301286H
• Product Overview: Recombinant Human FIGF protein(90-128 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 90-128 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKST
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: FIGF c-fos induced growth factor (vascular endothelial growth factor D) [ Homo sapiens ]
• Official Symbol: FIGF
• Synonyms: FIGF; c-fos induced growth factor (vascular endothelial growth factor D); VEGFD; vascular endothelial growth factor D; VEGF D; VEGF-D
• mRNA Refseq: NM_004469
• Protein Refseq: NP_004460
• MIM: 300091
• UniProt ID: O43915
• Gene ID: 2277