Recombinant Human FKBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FKBP2-3477H
Product Overview : FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128680) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Molecular Mass : 15.6 kDa
AA Sequence : MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FKBP2 FKBP prolyl isomerase 2 [ Homo sapiens (human) ]
Official Symbol FKBP2
Synonyms FKBP2; FK506 binding protein 2, 13kDa; FK506 binding protein 2 (13kD); peptidyl-prolyl cis-trans isomerase FKBP2; FKBP 13; peptidyl prolyl cis trans isomerase; PPIase; proline isomerase; rapamycin binding protein; FKBP-2; rotamase; 13 kDa FKBP; PPIase FKBP2; immunophilin FKBP13; rapamycin-binding protein; 13 kDa FK506-binding protein; FK506-binding protein 2 (13kD); FKBP-13;
Gene ID 2286
mRNA Refseq NM_001135208
Protein Refseq NP_001128680
MIM 186946
UniProt ID P26885

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP2 Products

Required fields are marked with *

My Review for All FKBP2 Products

Required fields are marked with *

0
cart-icon