Recombinant Human FKBP5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FKBP5-741H
Product Overview : FKBP5 MS Standard C13 and N15-labeled recombinant protein (NP_004108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
Molecular Mass : 51 kDa
AA Sequence : MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDLKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FKBP5 FK506 binding protein 5 [ Homo sapiens (human) ]
Official Symbol FKBP5
Synonyms FKBP5; FK506 binding protein 5; peptidyl-prolyl cis-trans isomerase FKBP5; FKBP51; FKBP54; P54; PPIase; Ptg 10; FKBP-5; FKBP-51; rotamase; 51 kDa FKBP; FF1 antigen; PPIase FKBP5; HSP90-binding immunophilin; T-cell FK506-binding protein; androgen-regulated protein 6; 51 kDa FK506-binding protein 5; peptidylprolyl cis-trans isomerase; 54 kDa progesterone receptor-associated immunophilin; AIG6; Ptg-10; MGC111006;
Gene ID 2289
mRNA Refseq NM_004117
Protein Refseq NP_004108
MIM 602623
UniProt ID Q13451

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP5 Products

Required fields are marked with *

My Review for All FKBP5 Products

Required fields are marked with *

0
cart-icon