Recombinant Human FKBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FKBP7-5061H |
Product Overview : | FKBP7 MS Standard C13 and N15-labeled recombinant protein (NP_851939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDELSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FKBP7 FK506 binding protein 7 [ Homo sapiens (human) ] |
Official Symbol | FKBP7 |
Synonyms | FKBP7; FK506 binding protein 7; peptidyl-prolyl cis-trans isomerase FKBP7; FKBP23; FKBP-7; FKBP-23; rotamase; 23 kDa FKBP; PPIase FKBP7; FK506-binding protein 7; FK506-binding protein 23; 23 kDa FK506-binding protein; PPIase; MGC9420; |
Gene ID | 51661 |
mRNA Refseq | NM_181342 |
Protein Refseq | NP_851939 |
MIM | 607062 |
UniProt ID | Q9Y680 |
◆ Recombinant Proteins | ||
Fkbp7-3030M | Recombinant Mouse Fkbp7 Protein, Myc/DDK-tagged | +Inquiry |
FKBP7-5911M | Recombinant Mouse FKBP7 Protein | +Inquiry |
FKBP7-3270M | Recombinant Mouse FKBP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP7-2753H | Recombinant Human FKBP7 Protein (Gln24-Leu222), C-His tagged | +Inquiry |
FKBP7-2349H | Recombinant Human FKBP7 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP7-1314HCL | Recombinant Human FKBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP7 Products
Required fields are marked with *
My Review for All FKBP7 Products
Required fields are marked with *