Recombinant Human FLNC Protein, GST-tagged
Cat.No. : | FLNC-4359H |
Product Overview : | Human FLNC partial ORF ( NP_001449.3, 2606 a.a. - 2705 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLNC filamin C, gamma [ Homo sapiens ] |
Official Symbol | FLNC |
Synonyms | FLNC; filamin C, gamma; filamin C, gamma (actin binding protein 280), FLN2; filamin-C; ABP 280; ABPL; actin binding protein 280; FLN-C; filamin 2; filamin-2; ABP-280-like protein; ABP-L, gamma filamin; actin-binding-like protein; ABPA; FLN2; MFM5; MPD4; ABP-280; ABP280A; FLJ10186; |
Gene ID | 2318 |
mRNA Refseq | NM_001127487 |
Protein Refseq | NP_001120959 |
MIM | 102565 |
UniProt ID | Q14315 |
◆ Recombinant Proteins | ||
FLNC-2017R | Recombinant Rat FLNC Protein, His (Fc)-Avi-tagged | +Inquiry |
FLNC-6142C | Recombinant Chicken FLNC | +Inquiry |
Flnc-1504M | Recombinant Mouse Flnc Protein, His-tagged | +Inquiry |
FLNC-1389H | Recombinant Human FLNC protein, His & T7-tagged | +Inquiry |
FLNC-3063H | Recombinant Human FLNC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FLNC-4360C | Native Chicken Filamin C, Gamma | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLNC Products
Required fields are marked with *
My Review for All FLNC Products
Required fields are marked with *