Recombinant Human FLNC protein, GST-tagged
| Cat.No. : | FLNC-301631H |
| Product Overview : | Recombinant Human FLNC protein(2161-2248 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2161-2248 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FLNC filamin C, gamma [ Homo sapiens ] |
| Official Symbol | FLNC |
| Synonyms | FLNC; filamin C, gamma; filamin C, gamma (actin binding protein 280) , FLN2; filamin-C; ABP 280; ABPL; actin binding protein 280; FLN-C; filamin 2; filamin-2; ABP-280-like protein; ABP-L, gamma filamin; actin-binding-like protein; ABPA; FLN2; MFM5; MPD4; ABP-280; ABP280A; FLJ10186; |
| Gene ID | 2318 |
| mRNA Refseq | NM_001127487 |
| Protein Refseq | NP_001120959 |
| MIM | 102565 |
| UniProt ID | Q14315 |
| ◆ Recombinant Proteins | ||
| Flnc-1504M | Recombinant Mouse Flnc Protein, His-tagged | +Inquiry |
| FLNC-3279M | Recombinant Mouse FLNC Protein, His (Fc)-Avi-tagged | +Inquiry |
| FLNC-1389H | Recombinant Human FLNC protein, His & T7-tagged | +Inquiry |
| FLNC-3063H | Recombinant Human FLNC protein, His-tagged | +Inquiry |
| FLNC-2725H | Recombinant Human FLNC Protein (Glu17-Lys259), N-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| FLNC-4360C | Native Chicken Filamin C, Gamma | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLNC Products
Required fields are marked with *
My Review for All FLNC Products
Required fields are marked with *




