Recombinant Human FLNC protein, GST-tagged
Cat.No. : | FLNC-301631H |
Product Overview : | Recombinant Human FLNC protein(2161-2248 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2161-2248 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | FLNC |
Synonyms | FLNC; filamin C, gamma; filamin C, gamma (actin binding protein 280) , FLN2; filamin-C; ABP 280; ABPL; actin binding protein 280; FLN-C; filamin 2; filamin-2; ABP-280-like protein; ABP-L, gamma filamin; actin-binding-like protein; ABPA; FLN2; MFM5; MPD4; ABP-280; ABP280A; FLJ10186; |
Gene ID | 2318 |
mRNA Refseq | NM_001127487 |
Protein Refseq | NP_001120959 |
MIM | 102565 |
UniProt ID | Q14315 |
◆ Recombinant Proteins | ||
FLNC-2017R | Recombinant Rat FLNC Protein, His (Fc)-Avi-tagged | +Inquiry |
Flnc-1504M | Recombinant Mouse Flnc Protein, His-tagged | +Inquiry |
FLNC-3279M | Recombinant Mouse FLNC Protein, His (Fc)-Avi-tagged | +Inquiry |
FLNC-1389H | Recombinant Human FLNC protein, His & T7-tagged | +Inquiry |
FLNC-2361R | Recombinant Rat FLNC Protein | +Inquiry |
◆ Native Proteins | ||
FLNC-4360C | Native Chicken Filamin C, Gamma | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLNC Products
Required fields are marked with *
My Review for All FLNC Products
Required fields are marked with *
0
Inquiry Basket