Recombinant Human FLNC protein, His-tagged

Cat.No. : FLNC-3063H
Product Overview : Recombinant Human FLNC protein(2161-2248 aa), fused to His tag, was expressed in E. coli.
Availability August 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2161-2248 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FLNC filamin C, gamma [ Homo sapiens ]
Official Symbol FLNC
Synonyms FLNC; filamin C, gamma; filamin C, gamma (actin binding protein 280) , FLN2; filamin-C; ABP 280; ABPL; actin binding protein 280; FLN-C; filamin 2; filamin-2; ABP-280-like protein; ABP-L, gamma filamin; actin-binding-like protein; ABPA; FLN2; MFM5; MPD4; ABP-280; ABP280A; FLJ10186;
Gene ID 2318
mRNA Refseq NM_001127487
Protein Refseq NP_001120959
MIM 102565
UniProt ID Q14315

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLNC Products

Required fields are marked with *

My Review for All FLNC Products

Required fields are marked with *

0
cart-icon