Recombinant Human FLNC protein, His-tagged
| Cat.No. : | FLNC-3063H |
| Product Overview : | Recombinant Human FLNC protein(2161-2248 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2161-2248 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FLNC filamin C, gamma [ Homo sapiens ] |
| Official Symbol | FLNC |
| Synonyms | FLNC; filamin C, gamma; filamin C, gamma (actin binding protein 280) , FLN2; filamin-C; ABP 280; ABPL; actin binding protein 280; FLN-C; filamin 2; filamin-2; ABP-280-like protein; ABP-L, gamma filamin; actin-binding-like protein; ABPA; FLN2; MFM5; MPD4; ABP-280; ABP280A; FLJ10186; |
| Gene ID | 2318 |
| mRNA Refseq | NM_001127487 |
| Protein Refseq | NP_001120959 |
| MIM | 102565 |
| UniProt ID | Q14315 |
| ◆ Recombinant Proteins | ||
| FLNC-2361R | Recombinant Rat FLNC Protein | +Inquiry |
| FLNC-3063H | Recombinant Human FLNC protein, His-tagged | +Inquiry |
| FLNC-6142C | Recombinant Chicken FLNC | +Inquiry |
| Flnc-1504M | Recombinant Mouse Flnc Protein, His-tagged | +Inquiry |
| FLNC-5922M | Recombinant Mouse FLNC Protein | +Inquiry |
| ◆ Native Proteins | ||
| FLNC-4360C | Native Chicken Filamin C, Gamma | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLNC Products
Required fields are marked with *
My Review for All FLNC Products
Required fields are marked with *
