Recombinant Human FLT4 Protein, GST-tagged
Cat.No. : | FLT4-4379H |
Product Overview : | Human FLT4 partial ORF ( NP_002011, 34 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLT4 fms-related tyrosine kinase 4 [ Homo sapiens ] |
Official Symbol | FLT4 |
Synonyms | FLT4; fms-related tyrosine kinase 4; vascular endothelial growth factor receptor 3; PCL; VEGFR3; FLT-4; VEGFR-3; soluble VEGFR3 variant 1; soluble VEGFR3 variant 2; soluble VEGFR3 variant 3; fms-like tyrosine kinase 4; tyrosine-protein kinase receptor FLT4; FLT41; LMPH1A; |
Gene ID | 2324 |
mRNA Refseq | NM_002020 |
Protein Refseq | NP_002011 |
MIM | 136352 |
UniProt ID | P35916 |
◆ Recombinant Proteins | ||
FLT4-940H | Recombinant Human FLT4 Protein, DDK/His-tagged | +Inquiry |
FLT4-86H | Recombinant Human Fms-related Tyrosine Kinase 4, 7 Domains, His-tagged | +Inquiry |
FLT4-391M | Active Recombinant Mouse FLT4 protein, mFc-tagged | +Inquiry |
FLT4-37HF | Recombinant Human FLT4 Protein, His-tagged, FITC conjugated | +Inquiry |
FLT4-31719TH | Recombinant Human FLT4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT4-2709HCL | Recombinant Human FLT4 cell lysate | +Inquiry |
FLT4-2016MCL | Recombinant Mouse FLT4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT4 Products
Required fields are marked with *
My Review for All FLT4 Products
Required fields are marked with *