Recombinant Human FLT4 Protein, GST-tagged

Cat.No. : FLT4-4379H
Product Overview : Human FLT4 partial ORF ( NP_002011, 34 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FLT4 fms-related tyrosine kinase 4 [ Homo sapiens ]
Official Symbol FLT4
Synonyms FLT4; fms-related tyrosine kinase 4; vascular endothelial growth factor receptor 3; PCL; VEGFR3; FLT-4; VEGFR-3; soluble VEGFR3 variant 1; soluble VEGFR3 variant 2; soluble VEGFR3 variant 3; fms-like tyrosine kinase 4; tyrosine-protein kinase receptor FLT4; FLT41; LMPH1A;
Gene ID 2324
mRNA Refseq NM_002020
Protein Refseq NP_002011
MIM 136352
UniProt ID P35916

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT4 Products

Required fields are marked with *

My Review for All FLT4 Products

Required fields are marked with *

0
cart-icon