"FLT4" Related Products

Expand
Expand

Recombinant Human FLT4 Protein, GST-tagged

Cat.No.: FLT4-4379H
Product Overview: Human FLT4 partial ORF ( NP_002011, 34 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 36.63 kDa
AA Sequence: ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FLT4 fms-related tyrosine kinase 4 [ Homo sapiens ]
Official Symbol: FLT4
Synonyms: FLT4; fms-related tyrosine kinase 4; vascular endothelial growth factor receptor 3; PCL; VEGFR3; FLT-4; VEGFR-3; soluble VEGFR3 variant 1; soluble VEGFR3 variant 2; soluble VEGFR3 variant 3; fms-like tyrosine kinase 4; tyrosine-protein kinase receptor FLT4; FLT41; LMPH1A;
Gene ID: 2324
mRNA Refseq: NM_002020
Protein Refseq: NP_002011
MIM: 136352
UniProt ID: P35916

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.