Recombinant Human FNDC4 Protein, GST-tagged
| Cat.No. : | FNDC4-4408H |
| Product Overview : | Human FNDC4 full-length ORF ( NP_073734.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FNDC4 (Fibronectin Type III Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is FNDC5. |
| Molecular Mass : | 51.6 kDa |
| AA Sequence : | MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FNDC4 fibronectin type III domain containing 4 [ Homo sapiens ] |
| Official Symbol | FNDC4 |
| Synonyms | FNDC4; fibronectin type III domain containing 4; fibronectin type III domain-containing protein 4; FLJ22362; FRCP1; fibronectin type III repeat-containing protein 1; |
| Gene ID | 64838 |
| mRNA Refseq | NM_022823 |
| Protein Refseq | NP_073734 |
| MIM | 611905 |
| UniProt ID | Q9H6D8 |
| ◆ Recombinant Proteins | ||
| FNDC4-685H | Recombinant Human FNDC4 Protein, Fc-tagged | +Inquiry |
| FNDC4-121H | Recombinant Human FNDC4 protein, T7/His-tagged | +Inquiry |
| Fndc4-3064M | Recombinant Mouse Fndc4 Protein, Myc/DDK-tagged | +Inquiry |
| FNDC4-1094HFL | Recombinant Full Length Human FNDC4 Protein, C-Flag-tagged | +Inquiry |
| RFL25848BF | Recombinant Full Length Bovine Fibronectin Type Iii Domain-Containing Protein 4(Fndc4) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FNDC4-6173HCL | Recombinant Human FNDC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNDC4 Products
Required fields are marked with *
My Review for All FNDC4 Products
Required fields are marked with *



