Recombinant Human FOLH1 Protein, GST-tagged
Cat.No. : | FOLH1-4417H |
Product Overview : | Human FOLH1 full-length ORF ( NP_001014986.1, 1 a.a. - 719 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq |
Molecular Mass : | 107 kDa |
AA Sequence : | MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSKHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOLH1 folate hydrolase (prostate-specific membrane antigen) 1 [ Homo sapiens ] |
Official Symbol | FOLH1 |
Synonyms | FOLH1; folate hydrolase (prostate-specific membrane antigen) 1; FOLH; glutamate carboxypeptidase 2; GCP2; GCPII; glutamate carboxylase II; glutamate carboxypeptidase II; NAALAD1; NAALAdase; PSM; PSMA; NAALADase I; membrane glutamate carboxypeptidase; cell growth-inhibiting gene 27 protein; folylpoly-gamma-glutamate carboxypeptidase; prostate specific membrane antigen variant F; pteroylpoly-gamma-glutamate carboxypeptidase; N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; FGCP; mGCP; |
Gene ID | 2346 |
mRNA Refseq | NM_001014986 |
Protein Refseq | NP_001014986 |
MIM | 600934 |
UniProt ID | Q04609 |
◆ Recombinant Proteins | ||
FOLH1-2430H | Recombinant Human FOLH1 Protein, MYC/DDK-tagged | +Inquiry |
FOLH1-2416HAF647 | Recombinant Human FOLH1 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
FOLH1-4852H | Active Recombinant Human FOLH1 Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
FOLH1-2938C | Recombinant Cynomolgus FOLH1 protein, His-tagged | +Inquiry |
Folh1-907M | Recombinant Mouse Folh1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLH1-2452MCL | Recombinant Mouse FOLH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOLH1 Products
Required fields are marked with *
My Review for All FOLH1 Products
Required fields are marked with *