Recombinant Human Forkhead box P3, GST-tagged
Cat.No. : | FOXP3-52H |
Product Overview : | Recombinant Human FOXP3 (1 a.a. - 431 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Mass : | 73.6 kDa |
Sequence : | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQL QLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVF SLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPE DFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCI VAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAIL APEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRP SRCSNPTPGP |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | FOXP3 |
Gene Name | FOXP3 forkhead box P3 [ Homo sapiens ] |
Synonyms | FOXP3; forkhead box P3; JM2; AIID; IPEX; PIDX; XPID; DIETER; forkhead box protein P3; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked |
Gene ID | 50943 |
mRNA Refseq | NM_014009 |
Protein Refseq | NP_054728 |
MIM | 300292 |
UniProt ID | Q9BZS1 |
Chromosome Location | Xp11.23 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes; IL2 signaling events mediated by STAT5 |
Function | DNA bending activity; NF-kappaB binding; NFAT protein binding; chromatin binding; double-stranded DNA binding |
◆ Recombinant Proteins | ||
Foxp3-1469M | Recombinant Mouse Foxp3 protein, His&Myc-tagged | +Inquiry |
FOXP3-1217H | Recombinant Human FOXP3 protein, His-tagged | +Inquiry |
FOXP3-51H | Recombinant Human Forkhead box P3, GST-tagged | +Inquiry |
FOXP3-52H | Recombinant Human Forkhead box P3, GST-tagged | +Inquiry |
FOXP3-2708H | Recombinant Human FOXP3 Protein (Gln105-Lys200), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXP3-6145HCL | Recombinant Human FOXP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXP3 Products
Required fields are marked with *
My Review for All FOXP3 Products
Required fields are marked with *
0
Inquiry Basket