Recombinant Human Forkhead box P3, GST-tagged
| Cat.No. : | FOXP3-52H |
| Product Overview : | Recombinant Human FOXP3 (1 a.a. - 431 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Molecular Mass : | 73.6 kDa |
| Sequence : | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQL QLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVF SLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPE DFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCI VAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAIL APEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRP SRCSNPTPGP |
| Purification : | Glutathione Sepharose 4 Fast Flow |
| Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note : | Best use within three months from the date of receipt of this protein. |
| OfficialSymbol : | FOXP3 |
| Gene Name | FOXP3 forkhead box P3 [ Homo sapiens ] |
| Synonyms | FOXP3; forkhead box P3; JM2; AIID; IPEX; PIDX; XPID; DIETER; forkhead box protein P3; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked |
| Gene ID | 50943 |
| mRNA Refseq | NM_014009 |
| Protein Refseq | NP_054728 |
| MIM | 300292 |
| UniProt ID | Q9BZS1 |
| Chromosome Location | Xp11.23 |
| Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes; IL2 signaling events mediated by STAT5 |
| Function | DNA bending activity; NF-kappaB binding; NFAT protein binding; chromatin binding; double-stranded DNA binding |
| ◆ Recombinant Proteins | ||
| FOXP3-51H | Recombinant Human Forkhead box P3, GST-tagged | +Inquiry |
| FOXP3-1746R | Recombinant Rhesus monkey FOXP3 Protein, His-tagged | +Inquiry |
| FOXP3-52H | Recombinant Human Forkhead box P3, GST-tagged | +Inquiry |
| FOXP3-1306HFL | Recombinant Full Length Human FOXP3 Protein, C-Flag-tagged | +Inquiry |
| FOXP3-50H | Recombinant Human FOXP3, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOXP3-6145HCL | Recombinant Human FOXP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP3 Products
Required fields are marked with *
My Review for All FOXP3 Products
Required fields are marked with *
