Recombinant Human Forkhead box P3, GST-tagged

• Cat.No.: FOXP3-52H
• Product Overview: Recombinant Human FOXP3 (1 a.a. - 431 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Mass: 73.6 kDa
• Sequence: MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQL QLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVF SLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPE DFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCI VAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAIL APEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRP SRCSNPTPGP
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Note: Best use within three months from the date of receipt of this protein.
• OfficialSymbol: FOXP3

Gene Information

• Gene Name: FOXP3 forkhead box P3 [ Homo sapiens ]
• Synonyms: FOXP3; forkhead box P3; JM2; AIID; IPEX; PIDX; XPID; DIETER; forkhead box protein P3; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked
• Gene ID: 50943
• mRNA Refseq: NM_014009
• Protein Refseq: NP_054728
• MIM: 300292
• UniProt ID: Q9BZS1
• Chromosome Location: Xp11.23
• Pathway: Calcineurin-regulated NFAT-dependent transcription in lymphocytes; IL2 signaling events mediated by STAT5
• Function: DNA bending activity; NF-kappaB binding; NFAT protein binding; chromatin binding; double-stranded DNA binding