Recombinant Human FOXP3 Protein, His-tagged
| Cat.No. : | FOXP3-1216H |
| Product Overview : | Recombinant Human FOXP3 Protein (1-260aa) was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-260 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 31.7 kDa |
| AA Sequence : | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | FOXP3 forkhead box P3 [ Homo sapiens ] |
| Official Symbol | FOXP3 |
| Synonyms | FOXP3; forkhead box P3; immune dysregulation, polyendocrinopathy, enteropathy, X linked , IPEX; forkhead box protein P3; AIID; DIETER; JM2; PIDX; SCURFIN; XPID; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; IPEX; MGC141961; MGC141963 |
| Gene ID | 50943 |
| mRNA Refseq | NM_001114377 |
| Protein Refseq | NP_001107849 |
| MIM | 300292 |
| UniProt ID | Q9BZS1 |
| ◆ Recombinant Proteins | ||
| Foxp3-1469M | Recombinant Mouse Foxp3 protein, His&Myc-tagged | +Inquiry |
| FOXP3-120H | Recombinant Human FOXP3 protein, His-tagged | +Inquiry |
| FOXP3-1215H | Recombinant Human FOXP3 protein, His-tagged | +Inquiry |
| FOXP3-720H | Recombinant Human FOXP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FOXP3-2708H | Recombinant Human FOXP3 Protein (Gln105-Lys200), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOXP3-6145HCL | Recombinant Human FOXP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP3 Products
Required fields are marked with *
My Review for All FOXP3 Products
Required fields are marked with *



