Recombinant Human FOXP3 Protein, His-tagged
Cat.No. : | FOXP3-1216H |
Product Overview : | Recombinant Human FOXP3 Protein (1-260aa) was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-260 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 31.7 kDa |
AA Sequence : | MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQ LPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGV FSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEE PEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | FOXP3 forkhead box P3 [ Homo sapiens ] |
Official Symbol | FOXP3 |
Synonyms | FOXP3; forkhead box P3; immune dysregulation, polyendocrinopathy, enteropathy, X linked , IPEX; forkhead box protein P3; AIID; DIETER; JM2; PIDX; SCURFIN; XPID; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; IPEX; MGC141961; MGC141963 |
Gene ID | 50943 |
mRNA Refseq | NM_001114377 |
Protein Refseq | NP_001107849 |
MIM | 300292 |
UniProt ID | Q9BZS1 |
◆ Recombinant Proteins | ||
FOXP3-1306HFL | Recombinant Full Length Human FOXP3 Protein, C-Flag-tagged | +Inquiry |
Foxp3-1919M | Recombinant Mouse Foxp3 protein, His & GST-tagged | +Inquiry |
FOXP3-6933HF | Recombinant Full Length Human FOXP3 Protein, GST-tagged | +Inquiry |
FOXP3-120H | Recombinant Human FOXP3 protein, His-tagged | +Inquiry |
FOXP3-2708H | Recombinant Human FOXP3 Protein (Gln105-Lys200), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXP3-6145HCL | Recombinant Human FOXP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP3 Products
Required fields are marked with *
My Review for All FOXP3 Products
Required fields are marked with *