Recombinant Human FOS Protein, His-tagged

Cat.No. : FOS-4893H
Product Overview : Recombinant Human FOS Protein was expressed in E. coli with His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
AA Sequence : ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FOS FBJ murine osteosarcoma viral oncogene homolog [ Homo sapiens ]
Official Symbol FOS
Synonyms FOS; FBJ murine osteosarcoma viral oncogene homolog; v fos FBJ murine osteosarcoma viral oncogene homolog; proto-oncogene c-Fos; AP 1; c fos; activator protein 1; cellular oncogene c-fos; G0/G1 switch regulatory protein 7; FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS); p55; AP-1; C-FOS;
Gene ID 2353
mRNA Refseq NM_005252
Protein Refseq NP_005243
MIM 164810
UniProt ID P01100

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOS Products

Required fields are marked with *

My Review for All FOS Products

Required fields are marked with *

0
cart-icon