Recombinant Human FOS Protein, His-tagged
Cat.No. : | FOS-4893H |
Product Overview : | Recombinant Human FOS Protein was expressed in E. coli with His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
AA Sequence : | ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FOS FBJ murine osteosarcoma viral oncogene homolog [ Homo sapiens ] |
Official Symbol | FOS |
Synonyms | FOS; FBJ murine osteosarcoma viral oncogene homolog; v fos FBJ murine osteosarcoma viral oncogene homolog; proto-oncogene c-Fos; AP 1; c fos; activator protein 1; cellular oncogene c-fos; G0/G1 switch regulatory protein 7; FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS); p55; AP-1; C-FOS; |
Gene ID | 2353 |
mRNA Refseq | NM_005252 |
Protein Refseq | NP_005243 |
MIM | 164810 |
UniProt ID | P01100 |
◆ Recombinant Proteins | ||
FOS-32H | Recombinant Human FOS protein, GST-tagged | +Inquiry |
Fos-940M | Recombinant Mouse Fos Protein, His-tagged | +Inquiry |
Fos-1639M | Recombinant Mouse Fos protein(1-380aa), His-tagged | +Inquiry |
FOS-7057C | Recombinant Chicken FOS | +Inquiry |
FOS-4893H | Recombinant Human FOS Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOS-6168HCL | Recombinant Human FOS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOS Products
Required fields are marked with *
My Review for All FOS Products
Required fields are marked with *