Recombinant Human FOSL1, GST-tagged
Cat.No. : | FOSL1-12965H |
Product Overview : | Recombinant Human FOSL1(1-271 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-271 aa |
Form : | Lyophilized from PBS, pH 7.0, 0.1% SKL, 1% Triton X-100, 5% Trehalose, 5% Mannitol. |
Molecular Mass : | The protein has a calculated MW of 56 kDa. |
AASequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method). |
Purity : | > 85 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.13mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | FOSL1 FOS-like antigen 1 [ Homo sapiens ] |
Official Symbol | FOSL1 |
Synonyms | FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1; |
Gene ID | 8061 |
mRNA Refseq | NM_005438 |
Protein Refseq | NP_005429 |
MIM | 136515 |
UniProt ID | P15407 |
◆ Recombinant Proteins | ||
FOSL1-3311M | Recombinant Mouse FOSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOSL1-28947TH | Recombinant Human FOSL1, His-tagged | +Inquiry |
FOSL1-2065HFL | Recombinant Full Length Human FOSL1 Protein, C-Flag-tagged | +Inquiry |
FOSL1-2037R | Recombinant Rat FOSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOSL1-1034H | Active Recombinant Human FOS-like Antigen 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL1 Products
Required fields are marked with *
My Review for All FOSL1 Products
Required fields are marked with *