Recombinant Human FOSL1, GST-tagged

• Cat.No.: FOSL1-12965H
• Product Overview: Recombinant Human FOSL1(1-271 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-271 aa
• Form: Lyophilized from PBS, pH 7.0, 0.1% SKL, 1% Triton X-100, 5% Trehalose, 5% Mannitol.
• Molecular Mass: The protein has a calculated MW of 56 kDa.
• AASequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
• Endotoxin: <1.0EU per 1µg (determined by the LAL method).
• Purity: > 85 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.13mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: FOSL1 FOS-like antigen 1 [ Homo sapiens ]
• Official Symbol: FOSL1
• Synonyms: FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1
• Gene ID: 8061
• mRNA Refseq: NM_005438
• Protein Refseq: NP_005429
• MIM: 136515
• UniProt ID: P15407