Recombinant Human FOSL1, GST-tagged
| Cat.No. : | FOSL1-12965H |
| Product Overview : | Recombinant Human FOSL1(1-271 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-271 aa |
| Form : | Lyophilized from PBS, pH 7.0, 0.1% SKL, 1% Triton X-100, 5% Trehalose, 5% Mannitol. |
| Molecular Mass : | The protein has a calculated MW of 56 kDa. |
| AASequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL |
| Endotoxin : | <1.0EU per 1µg (determined by the LAL method). |
| Purity : | > 85 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.13mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | FOSL1 FOS-like antigen 1 [ Homo sapiens ] |
| Official Symbol | FOSL1 |
| Synonyms | FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1; |
| Gene ID | 8061 |
| mRNA Refseq | NM_005438 |
| Protein Refseq | NP_005429 |
| MIM | 136515 |
| UniProt ID | P15407 |
| ◆ Recombinant Proteins | ||
| FOSL1-3311M | Recombinant Mouse FOSL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fosl1-1623R | Recombinant Rat Fosl1 protein, His & GST-tagged | +Inquiry |
| FOSL1-12965H | Recombinant Human FOSL1, GST-tagged | +Inquiry |
| FOSL1-5606H | Recombinant Human FOSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Fosl1-7853M | Recombinant Mouse Fosl1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL1 Products
Required fields are marked with *
My Review for All FOSL1 Products
Required fields are marked with *
