Recombinant Human FOSL1, GST-tagged

Cat.No. : FOSL1-12965H
Product Overview : Recombinant Human FOSL1(1-271 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability July 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-271 aa
Form : Lyophilized from PBS, pH 7.0, 0.1% SKL, 1% Triton X-100, 5% Trehalose, 5% Mannitol.
Molecular Mass : The protein has a calculated MW of 56 kDa.
AASequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
Endotoxin : <1.0EU per 1µg (determined by the LAL method).
Purity : > 85 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.13mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name FOSL1 FOS-like antigen 1 [ Homo sapiens ]
Official Symbol FOSL1
Synonyms FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1;
Gene ID 8061
mRNA Refseq NM_005438
Protein Refseq NP_005429
MIM 136515
UniProt ID P15407

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOSL1 Products

Required fields are marked with *

My Review for All FOSL1 Products

Required fields are marked with *

0
cart-icon