Recombinant Human FOXC2

Cat.No. : FOXC2-28108TH
Product Overview : Recombinant fragment, corresponding to amino acids 421-501 of Human FOXC2, with an N-terminal proprietary tag, predicted MWt 35.02 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 81 amino acids
Description : This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.
Molecular Weight : 35.020kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Sequence Similarities : Contains 1 fork-head DNA-binding domain.
Gene Name FOXC2 forkhead box C2 (MFH-1, mesenchyme forkhead 1) [ Homo sapiens ]
Official Symbol FOXC2
Synonyms FOXC2; forkhead box C2 (MFH-1, mesenchyme forkhead 1); FKHL14; forkhead box protein C2; MFH 1;
Gene ID 2303
mRNA Refseq NM_005251
Protein Refseq NP_005242
MIM 602402
Uniprot ID Q99958
Chromosome Location 16q24.1
Pathway Adipogenesis, organism-specific biosystem; Heart Development, organism-specific biosystem;
Function DNA bending activity; chromatin DNA binding; double-stranded DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXC2 Products

Required fields are marked with *

My Review for All FOXC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon