Recombinant Human FOXC2

• Cat.No.: FOXC2-28108TH
• Product Overview: Recombinant fragment, corresponding to amino acids 421-501 of Human FOXC2, with an N-terminal proprietary tag, predicted MWt 35.02 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 81 amino acids
• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain.The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.
• Molecular Weight: 35.020kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
• Sequence Similarities: Contains 1 fork-head DNA-binding domain.

Gene Information

• Gene Name: FOXC2 forkhead box C2 (MFH-1, mesenchyme forkhead 1) [ Homo sapiens ]
• Official Symbol: FOXC2
• Synonyms: FOXC2; forkhead box C2 (MFH-1, mesenchyme forkhead 1); FKHL14; forkhead box protein C2; MFH 1
• Gene ID: 2303
• mRNA Refseq: NM_005251
• Protein Refseq: NP_005242
• MIM: 602402
• Uniprot ID: Q99958
• Chromosome Location: 16q24.1
• Pathway: Adipogenesis, organism-specific biosystem; Heart Development, organism-specific biosystem
• Function: DNA bending activity; chromatin DNA binding; double-stranded DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity