Recombinant Human FOXC2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FOXC2-3485H |
Product Overview : | FOXC2 MS Standard C13 and N15-labeled recombinant protein (NP_005242) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. |
Molecular Mass : | 53.5 kDa |
AA Sequence : | MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FOXC2 forkhead box C2 [ Homo sapiens (human) ] |
Official Symbol | FOXC2 |
Synonyms | FOXC2; forkhead box C2 (MFH-1, mesenchyme forkhead 1); FKHL14; forkhead box protein C2; MFH 1; MFH-1,mesenchyme forkhead 1; transcription factor FKH-14; mesenchyme fork head protein 1; forkhead-related protein FKHL14; forkhead, Drosophila, homolog-like 14; LD; MFH1; MFH-1; |
Gene ID | 2303 |
mRNA Refseq | NM_005251 |
Protein Refseq | NP_005242 |
MIM | 602402 |
UniProt ID | Q99958 |
◆ Recombinant Proteins | ||
FOXC2-5051HF | Recombinant Full Length Human FOXC2 Protein, GST-tagged | +Inquiry |
FOXC2-28108TH | Recombinant Human FOXC2 | +Inquiry |
FOXC2-6161H | Recombinant Human FOXC2 protein, His-tagged | +Inquiry |
FOXC2-6695C | Recombinant Chicken FOXC2 | +Inquiry |
FOXC2-4438H | Recombinant Human FOXC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXC2-6160HCL | Recombinant Human FOXC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOXC2 Products
Required fields are marked with *
My Review for All FOXC2 Products
Required fields are marked with *
0
Inquiry Basket