Recombinant Human FOXF1 Protein, GST-tagged

Cat.No. : FOXF1-4448H
Product Overview : Human FOXF1 full-length ORF ( ACE87508.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. [provided by RefSeq
Molecular Mass : 65.34 kDa
AA Sequence : MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCVM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXF1 forkhead box F1 [ Homo sapiens ]
Official Symbol FOXF1
Synonyms FOXF1; forkhead box F1; FKHL5; forkhead box protein F1; FREAC1; FREAC-1; forkhead-related activator 1; forkhead-related protein FKHL5; Forkhead, drosophila, homolog-like 5; forkhead-related transcription factor 1; ACDMPV; MGC105125;
Gene ID 2294
mRNA Refseq NM_001451
Protein Refseq NP_001442
MIM 601089
UniProt ID Q12946

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXF1 Products

Required fields are marked with *

My Review for All FOXF1 Products

Required fields are marked with *

0
cart-icon