Recombinant Human FOXM1 Protein, His-SUMO/MYC-tagged
| Cat.No. : | FOXM1-1215H |
| Product Overview : | Recombinant Human FOXM1 Protein (235-327aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 235-327 a.a. |
| Description : | The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript variants encoding different isoforms have been found for this gene. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 31.2 kDa |
| AA Sequence : | ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGK VSFWTIHPSANRYLTLDQVFKPL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | FOXM1 forkhead box M1 [ Homo sapiens (human) ] |
| Official Symbol | FOXM1 |
| Synonyms | MPP2; HFH11; HNF-3; INS-1; MPP-2; PIG29; FKHL16; FOXM1B; HFH-11; TRIDENT; MPHOSPH2; FOXM1 |
| Gene ID | 2305 |
| mRNA Refseq | NM_202002.2 |
| Protein Refseq | NP_973731.1 |
| MIM | 602341 |
| UniProt ID | Q08050 |
| ◆ Recombinant Proteins | ||
| FOxM1-1346H | Recombinant Human FOxM1 protein, GST-tagged | +Inquiry |
| FOXM1-3162H | Recombinant Human FOXM1 protein, His-tagged | +Inquiry |
| Foxm1-1522M | Recombinant Mouse Foxm1 Protein, His-tagged | +Inquiry |
| Foxm1-7640R | Recombinant Rat Foxm1 protein, His & T7-tagged | +Inquiry |
| FOXM1-5098HF | Recombinant Full Length Human FOXM1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOXM1-6152HCL | Recombinant Human FOXM1 293 Cell Lysate | +Inquiry |
| FOXM1-6153HCL | Recombinant Human FOXM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXM1 Products
Required fields are marked with *
My Review for All FOXM1 Products
Required fields are marked with *
