Recombinant Human FOXM1 protein, His-tagged

• Cat.No.: FOXM1-3162H
• Product Overview: Recombinant Human FOXM1 protein(91-237 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 91-237 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FOXM1 forkhead box M1 [ Homo sapiens ]
• Official Symbol: FOXM1
• Synonyms: FOXM1; forkhead box M1; FKHL16; forkhead box protein M1; HFH 11; HNF 3; INS 1; M phase phosphoprotein 2; MPHOSPH2; MPP2; TGT3; trident; M-phase phosphoprotein 2; HNF-3/fork-head homolog 11; transcription factor Trident; MPM-2 reactive phosphoprotein 2; forkhead-related protein FKHL16; winged-helix factor from INS-1 cells; Forkhead, drosophila, homolog-like 16; hepatocyte nuclear factor 3 forkhead homolog 11; HFH11; HNF-3; INS-1; MPP-2; PIG29; FOXM1B; HFH-11; TRIDENT
• Gene ID: 2305
• mRNA Refseq: NM_001243088
• Protein Refseq: NP_001230017
• MIM: 602341
• UniProt ID: Q08050