Recombinant Human FOXM1 protein, His-tagged
Cat.No. : | FOXM1-3162H |
Product Overview : | Recombinant Human FOXM1 protein(91-237 aa), fused to His tag, was expressed in E. coli. |
Availability | September 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-237 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FOXM1 forkhead box M1 [ Homo sapiens ] |
Official Symbol | FOXM1 |
Synonyms | FOXM1; forkhead box M1; FKHL16; forkhead box protein M1; HFH 11; HNF 3; INS 1; M phase phosphoprotein 2; MPHOSPH2; MPP2; TGT3; trident; M-phase phosphoprotein 2; HNF-3/fork-head homolog 11; transcription factor Trident; MPM-2 reactive phosphoprotein 2; forkhead-related protein FKHL16; winged-helix factor from INS-1 cells; Forkhead, drosophila, homolog-like 16; hepatocyte nuclear factor 3 forkhead homolog 11; HFH11; HNF-3; INS-1; MPP-2; PIG29; FOXM1B; HFH-11; TRIDENT; |
Gene ID | 2305 |
mRNA Refseq | NM_001243088 |
Protein Refseq | NP_001230017 |
MIM | 602341 |
UniProt ID | Q08050 |
◆ Recombinant Proteins | ||
FOXM1-2560H | Recombinant Human FOXM1 Protein, GST/His-tagged | +Inquiry |
FOXM1-4464H | Recombinant Human FOXM1 Protein, GST-tagged | +Inquiry |
FOXM1-5098HF | Recombinant Full Length Human FOXM1 Protein, GST-tagged | +Inquiry |
FOXM1-11319Z | Recombinant Zebrafish FOXM1 | +Inquiry |
FOXM1-3162H | Recombinant Human FOXM1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXM1-6152HCL | Recombinant Human FOXM1 293 Cell Lysate | +Inquiry |
FOXM1-6153HCL | Recombinant Human FOXM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXM1 Products
Required fields are marked with *
My Review for All FOXM1 Products
Required fields are marked with *