Recombinant Human FOXM1 protein, His-tagged

Cat.No. : FOXM1-3162H
Product Overview : Recombinant Human FOXM1 protein(91-237 aa), fused to His tag, was expressed in E. coli.
Availability September 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 91-237 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : LTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERP
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FOXM1 forkhead box M1 [ Homo sapiens ]
Official Symbol FOXM1
Synonyms FOXM1; forkhead box M1; FKHL16; forkhead box protein M1; HFH 11; HNF 3; INS 1; M phase phosphoprotein 2; MPHOSPH2; MPP2; TGT3; trident; M-phase phosphoprotein 2; HNF-3/fork-head homolog 11; transcription factor Trident; MPM-2 reactive phosphoprotein 2; forkhead-related protein FKHL16; winged-helix factor from INS-1 cells; Forkhead, drosophila, homolog-like 16; hepatocyte nuclear factor 3 forkhead homolog 11; HFH11; HNF-3; INS-1; MPP-2; PIG29; FOXM1B; HFH-11; TRIDENT;
Gene ID 2305
mRNA Refseq NM_001243088
Protein Refseq NP_001230017
MIM 602341
UniProt ID Q08050

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXM1 Products

Required fields are marked with *

My Review for All FOXM1 Products

Required fields are marked with *

0
cart-icon