| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
80-427 a.a. |
| Description : |
This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Conjugation : |
HIS |
| Form : |
Lyophilised:Reconstitute with 162 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
GLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQ VLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQ LLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQH LLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWK EVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNP HASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWP GCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQ QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVS SVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTT |
| Sequence Similarities : |
Contains 1 C2H2-type zinc finger.Contains 1 fork-head DNA-binding domain. |