Recombinant Human FOXP1, His-tagged
Cat.No. : | FOXP1-28111TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 80-427 of Human FOXP1 with N terminal His tag; Predicted MWt 40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 80-427 a.a. |
Description : | This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 162 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQ VLSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQ LLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQH LLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWK EVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNP HASTNGQLSVHTPKRESLSHEEHPHSHPLYGHGVCKWP GCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQ QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVS SVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTT |
Sequence Similarities : | Contains 1 C2H2-type zinc finger.Contains 1 fork-head DNA-binding domain. |
Gene Name | FOXP1 forkhead box P1 [ Homo sapiens ] |
Official Symbol | FOXP1 |
Synonyms | FOXP1; forkhead box P1; forkhead box protein P1; 12CC4; fork head related protein like B; glutamine rich factor 1; hFKH1B; HSPC215; PAX5/FOXP1 fusion protein; QRF1; |
Gene ID | 27086 |
mRNA Refseq | NM_001012505 |
Protein Refseq | NP_001012523 |
MIM | 605515 |
Uniprot ID | Q9H334 |
Chromosome Location | 3p14.1 |
Function | DNA bending activity; chromatin binding; double-stranded DNA binding; metal ion binding; protein heterodimerization activity; |
◆ Recombinant Proteins | ||
FOXP1-28111TH | Recombinant Human FOXP1, His-tagged | +Inquiry |
FOXP1-1744R | Recombinant Rhesus monkey FOXP1 Protein, His-tagged | +Inquiry |
FOXP1-2388R | Recombinant Rat FOXP1 Protein | +Inquiry |
FOXP1-5163H | Recombinant Human FOXP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FOXP1-2625H | Recombinant Human FOXP1 Protein (Asn461-Pro671), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXP1-6146HCL | Recombinant Human FOXP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP1 Products
Required fields are marked with *
My Review for All FOXP1 Products
Required fields are marked with *
0
Inquiry Basket