Recombinant Human FOXP3 protein, His-tagged

• Cat.No.: FOXP3-59H
• Product Overview: Recombinant Human FOXP3 protein(230-431 aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 230-431 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: AQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FOXP3 forkhead box P3 [ Homo sapiens ]
• Official Symbol: FOXP3
• Synonyms: FOXP3; forkhead box P3; immune dysregulation, polyendocrinopathy, enteropathy, X linked , IPEX; forkhead box protein P3; AIID; DIETER; JM2; PIDX; SCURFIN; XPID; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; IPEX; MGC141961; MGC141963
• Gene ID: 50943
• mRNA Refseq: NM_001114377
• Protein Refseq: NP_001107849
• MIM: 300292
• UniProt ID: Q9BZS1