Recombinant Human FOXP3 protein, His-tagged
Cat.No. : | FOXP3-59H |
Product Overview : | Recombinant Human FOXP3 protein(230-431 aa), fused to N-terminal His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 230-431 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FOXP3 forkhead box P3 [ Homo sapiens ] |
Official Symbol | FOXP3 |
Synonyms | FOXP3; forkhead box P3; immune dysregulation, polyendocrinopathy, enteropathy, X linked , IPEX; forkhead box protein P3; AIID; DIETER; JM2; PIDX; SCURFIN; XPID; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; IPEX; MGC141961; MGC141963; |
Gene ID | 50943 |
mRNA Refseq | NM_001114377 |
Protein Refseq | NP_001107849 |
MIM | 300292 |
UniProt ID | Q9BZS1 |
◆ Recombinant Proteins | ||
FOXP3-938H | Recombinant Human FOXP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXP3-6933HF | Recombinant Full Length Human FOXP3 Protein, GST-tagged | +Inquiry |
FOXP3-1746R | Recombinant Rhesus monkey FOXP3 Protein, His-tagged | +Inquiry |
FOXP3-2708H | Recombinant Human FOXP3 Protein (Gln105-Lys200), N-His tagged | +Inquiry |
FOXP3-52H | Recombinant Human Forkhead box P3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXP3-6145HCL | Recombinant Human FOXP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP3 Products
Required fields are marked with *
My Review for All FOXP3 Products
Required fields are marked with *