Recombinant Human FOXP3 protein, His-tagged

Cat.No. : FOXP3-59H
Product Overview : Recombinant Human FOXP3 protein(230-431 aa), fused to N-terminal His tag, was expressed in E. coli.
Availability October 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 230-431 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : AQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name FOXP3 forkhead box P3 [ Homo sapiens ]
Official Symbol FOXP3
Synonyms FOXP3; forkhead box P3; immune dysregulation, polyendocrinopathy, enteropathy, X linked , IPEX; forkhead box protein P3; AIID; DIETER; JM2; PIDX; SCURFIN; XPID; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; IPEX; MGC141961; MGC141963;
Gene ID 50943
mRNA Refseq NM_001114377
Protein Refseq NP_001107849
MIM 300292
UniProt ID Q9BZS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOXP3 Products

Required fields are marked with *

My Review for All FOXP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon