Recombinant Human FOXP3 protein, His-tagged
| Cat.No. : | FOXP3-59H |
| Product Overview : | Recombinant Human FOXP3 protein(230-431 aa), fused to N-terminal His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 230-431 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | AQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FOXP3 forkhead box P3 [ Homo sapiens ] |
| Official Symbol | FOXP3 |
| Synonyms | FOXP3; forkhead box P3; immune dysregulation, polyendocrinopathy, enteropathy, X linked , IPEX; forkhead box protein P3; AIID; DIETER; JM2; PIDX; SCURFIN; XPID; scurfin; FOXP3delta7; immunodeficiency, polyendocrinopathy, enteropathy, X-linked; immune dysregulation, polyendocrinopathy, enteropathy, X-linked; IPEX; MGC141961; MGC141963; |
| Gene ID | 50943 |
| mRNA Refseq | NM_001114377 |
| Protein Refseq | NP_001107849 |
| MIM | 300292 |
| UniProt ID | Q9BZS1 |
| ◆ Recombinant Proteins | ||
| FOXP3-50H | Recombinant Human FOXP3, MYC/DDK-tagged | +Inquiry |
| FOXP3-1746R | Recombinant Rhesus monkey FOXP3 Protein, His-tagged | +Inquiry |
| FOXP3-6933HF | Recombinant Full Length Human FOXP3 Protein, GST-tagged | +Inquiry |
| FOXP3-1217H | Recombinant Human FOXP3 protein, His-tagged | +Inquiry |
| FOXP3-120H | Recombinant Human FOXP3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOXP3-6145HCL | Recombinant Human FOXP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP3 Products
Required fields are marked with *
My Review for All FOXP3 Products
Required fields are marked with *
