Recombinant Human FOXQ1 Protein, GST-tagged
Cat.No. : | FOXQ1-4477H |
Product Overview : | Human FOXQ1 partial ORF ( NP_150285, 110 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM |
Molecular Mass : | 37.84 kDa |
AA Sequence : | RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXQ1 forkhead box Q1 [ Homo sapiens ] |
Official Symbol | FOXQ1 |
Synonyms | FOXQ1; forkhead box Q1; forkhead box protein Q1; HFH1; HFH-1; HNF-3/forkhead-like protein 1; winged helix/forkhead transcription factor; hepatocyte nuclear factor 3 forkhead homolog 1; |
Gene ID | 94234 |
mRNA Refseq | NM_033260 |
Protein Refseq | NP_150285 |
MIM | 612788 |
UniProt ID | Q9C009 |
◆ Recombinant Proteins | ||
Foxq1-3081M | Recombinant Mouse Foxq1 Protein, Myc/DDK-tagged | +Inquiry |
FOXQ1-2046R | Recombinant Rat FOXQ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXQ1-3340M | Recombinant Mouse FOXQ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXQ1-2158H | Recombinant Human FOXQ1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FOXQ1-6014M | Recombinant Mouse FOXQ1 Protein | +Inquiry |
◆ Native Proteins | ||
FOXQ1-2159H | Recombinant Full Length Human FOXQ1 Protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXQ1-6144HCL | Recombinant Human FOXQ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXQ1 Products
Required fields are marked with *
My Review for All FOXQ1 Products
Required fields are marked with *
0
Inquiry Basket