Recombinant Human FPGS Protein, GST-tagged
Cat.No. : | FPGS-4483H |
Product Overview : | Human FPGS partial ORF ( NP_004948, 135 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms. [provided by RefSeq |
Molecular Mass : | 36.52 kDa |
AA Sequence : | QVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FPGS folylpolyglutamate synthase [ Homo sapiens ] |
Official Symbol | FPGS |
Synonyms | FPGS; folylpolyglutamate synthase; folylpolyglutamate synthase, mitochondrial; tetrahydrofolate synthase; folylpoly-gamma-glutamate synthetase; tetrahydrofolylpolyglutamate synthase; |
Gene ID | 2356 |
mRNA Refseq | NM_001018078 |
Protein Refseq | NP_001018088 |
MIM | 136510 |
UniProt ID | Q05932 |
◆ Recombinant Proteins | ||
FPGS-6020M | Recombinant Mouse FPGS Protein | +Inquiry |
Fpgs-739M | Recombinant Mouse Fpgs Protein, His-tagged | +Inquiry |
FPGS-4483H | Recombinant Human FPGS Protein, GST-tagged | +Inquiry |
FPGS-3345M | Recombinant Mouse FPGS Protein, His (Fc)-Avi-tagged | +Inquiry |
FPGS-12608Z | Recombinant Zebrafish FPGS | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPGS Products
Required fields are marked with *
My Review for All FPGS Products
Required fields are marked with *