Recombinant Human FPGS Protein, GST-tagged

• Cat.No.: FPGS-4483H
• Product Overview: Human FPGS partial ORF ( NP_004948, 135 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms. [provided by RefSeq
• Molecular Mass: 36.52 kDa
• AA Sequence: QVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FPGS folylpolyglutamate synthase [ Homo sapiens ]
• Official Symbol: FPGS
• Synonyms: FPGS; folylpolyglutamate synthase; folylpolyglutamate synthase, mitochondrial; tetrahydrofolate synthase; folylpoly-gamma-glutamate synthetase; tetrahydrofolylpolyglutamate synthase
• Gene ID: 2356
• mRNA Refseq: NM_001018078
• Protein Refseq: NP_001018088
• MIM: 136510
• UniProt ID: Q05932