Recombinant Human FPGS Protein, GST-tagged

Cat.No. : FPGS-4483H
Product Overview : Human FPGS partial ORF ( NP_004948, 135 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms. [provided by RefSeq
Molecular Mass : 36.52 kDa
AA Sequence : QVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FPGS folylpolyglutamate synthase [ Homo sapiens ]
Official Symbol FPGS
Synonyms FPGS; folylpolyglutamate synthase; folylpolyglutamate synthase, mitochondrial; tetrahydrofolate synthase; folylpoly-gamma-glutamate synthetase; tetrahydrofolylpolyglutamate synthase;
Gene ID 2356
mRNA Refseq NM_001018078
Protein Refseq NP_001018088
MIM 136510
UniProt ID Q05932

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FPGS Products

Required fields are marked with *

My Review for All FPGS Products

Required fields are marked with *

0
cart-icon