Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged
| Cat.No. : | FPR1-2489H |
| Product Overview : | Recombinant Human FPR1 Protein (306-350 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His&Myc |
| Protein Length : | 306-350 aa |
| Description : | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 34.9 kDa |
| AA Sequence : | QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | FPR1 formyl peptide receptor 1 [ Homo sapiens ] |
| Official Symbol | FPR1 |
| Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; |
| Gene ID | 2357 |
| mRNA Refseq | NM_001193306 |
| Protein Refseq | NP_001180235 |
| MIM | 136537 |
| UniProt ID | P21462 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *
