Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged
Cat.No. : | FPR1-2489H |
Product Overview : | Recombinant Human FPR1 Protein (306-350 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 306-350 aa |
Description : | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.9 kDa |
AA Sequence : | QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | FPR1 formyl peptide receptor 1 [ Homo sapiens ] |
Official Symbol | FPR1 |
Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; |
Gene ID | 2357 |
mRNA Refseq | NM_001193306 |
Protein Refseq | NP_001180235 |
MIM | 136537 |
UniProt ID | P21462 |
◆ Recombinant Proteins | ||
FPR1-3346M | Recombinant Mouse FPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FPR1-2489H | Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged | +Inquiry |
FPR1-2444M | Recombinant Mouse FPR1 Protein (1-35 aa), His-GST-Myc-tagged | +Inquiry |
FPR1-6022M | Recombinant Mouse FPR1 Protein | +Inquiry |
FPR1-2994H | Recombinant Human FPR1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *