Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged

Cat.No. : FPR1-2489H
Product Overview : Recombinant Human FPR1 Protein (306-350 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His&Myc
Protein Length : 306-350 aa
Description : High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.9 kDa
AA Sequence : QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name FPR1 formyl peptide receptor 1 [ Homo sapiens ]
Official Symbol FPR1
Synonyms FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor;
Gene ID 2357
mRNA Refseq NM_001193306
Protein Refseq NP_001180235
MIM 136537
UniProt ID P21462

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FPR1 Products

Required fields are marked with *

My Review for All FPR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon