Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged

• Cat.No.: FPR1-2489H
• Product Overview: Recombinant Human FPR1 Protein (306-350 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Description: High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
• Source: E. coli
• Species: Human
• Tag: His-GST-Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.9 kDa
• Protein length: 306-350 aa
• AA Sequence: QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: FPR1 formyl peptide receptor 1 [ Homo sapiens ]
• Official Symbol: FPR1
• Synonyms: FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor
• Gene ID: 2357
• mRNA Refseq: NM_001193306
• Protein Refseq: NP_001180235
• MIM: 136537
• UniProt ID: P21462