Recombinant Human FSTL3 Protein, His&Avi tagged

• Cat.No.: FSTL3-940H
• Product Overview: Recombinant Human FSTL3 Protein with His&Avi tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Avi&His
• Protein Length: 1-263 aa
• Description: Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis.
• Molecular Mass: 28 kDa
• AA Sequence: MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVGSGSGSHHHHHHGLNDIFEAQKIEWHE
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.42 mg/mL by BCA

Gene Information

• Gene Name: FSTL3 follistatin-like 3 (secreted glycoprotein) [ Homo sapiens (human) ]
• Official Symbol: FSTL3
• Synonyms: FSTL3; follistatin-like 3 (secreted glycoprotein); follistatin-related protein 3; FLRG; follistatin related protein; FSRP; follistatin-like protein 3; follistatin-related gene protein
• Gene ID: 10272
• mRNA Refseq: NM_005860
• Protein Refseq: NP_005851
• MIM: 605343
• UniProt ID: O95633