Recombinant Human FSTL3 Protein, His&Avi tagged
| Cat.No. : | FSTL3-940H |
| Product Overview : | Recombinant Human FSTL3 Protein with His&Avi tag was expressed in HEK293. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Avi&His |
| Protein Length : | 1-263 aa |
| Description : | Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis. |
| Molecular Mass : | 28 kDa |
| AA Sequence : | MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVGSGSGSHHHHHHGLNDIFEAQKIEWHE |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.42 mg/mL by BCA |
| Gene Name | FSTL3 follistatin-like 3 (secreted glycoprotein) [ Homo sapiens (human) ] |
| Official Symbol | FSTL3 |
| Synonyms | FSTL3; follistatin-like 3 (secreted glycoprotein); follistatin-related protein 3; FLRG; follistatin related protein; FSRP; follistatin-like protein 3; follistatin-related gene protein |
| Gene ID | 10272 |
| mRNA Refseq | NM_005860 |
| Protein Refseq | NP_005851 |
| MIM | 605343 |
| UniProt ID | O95633 |
| ◆ Recombinant Proteins | ||
| FSTL3-4527H | Recombinant Human FSTL3 Protein, GST-tagged | +Inquiry |
| FSTL3-558H | Recombinant Human FSTL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Fstl3-715M | Recombinant Mouse Fstl3 protein, His-tagged | +Inquiry |
| FSTL3-2056R | Recombinant Rat FSTL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FSTL3-2981H | Recombinant Human FSTL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FSTL3-2793MCL | Recombinant Mouse FSTL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FSTL3 Products
Required fields are marked with *
My Review for All FSTL3 Products
Required fields are marked with *
