Recombinant Human FSTL3 Protein, His&Avi tagged

Cat.No. : FSTL3-940H
Product Overview : Recombinant Human FSTL3 Protein with His&Avi tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Avi&His
Protein Length : 1-263 aa
Description : Follistatin-like 3 is a secreted glycoprotein of the follistatin-module-protein family. It may have a role in leukemogenesis.
Molecular Mass : 28 kDa
AA Sequence : MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGHPDLSVMYRGRCRKSCEHVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNVTYISSCHMRQATCFLGRSIGVRHAGSCAGTPEEPPGGESAEEEENFVGSGSGSHHHHHHGLNDIFEAQKIEWHE
Endotoxin : <1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.42 mg/mL by BCA
Gene Name FSTL3 follistatin-like 3 (secreted glycoprotein) [ Homo sapiens (human) ]
Official Symbol FSTL3
Synonyms FSTL3; follistatin-like 3 (secreted glycoprotein); follistatin-related protein 3; FLRG; follistatin related protein; FSRP; follistatin-like protein 3; follistatin-related gene protein
Gene ID 10272
mRNA Refseq NM_005860
Protein Refseq NP_005851
MIM 605343
UniProt ID O95633

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FSTL3 Products

Required fields are marked with *

My Review for All FSTL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon