Recombinant Human FTO, GST-tagged

Cat.No. : FTO-118H
Product Overview : Human FTO full-length ORF ( AAH01284.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a nuclear protein of the AlkB related non-haem iron and 2-oxoglutarate-dependent oxygenase superfamily but the exact physiological function of this gene is not known. Other non-heme iron enzymes function to reverse alkylated DNA and RNA damage by oxidative demethylation. Studies in mice and humans indicate a role in nervous and cardiovascular systems and a strong association with body mass index, obesity risk, and type 2 diabetes.
Molecular Mass : 41.8 kDa
AA Sequence : MGHPRAIQPSVFFSPYDVHFLLYPIRCPYLKIGRFHIKLKGLHFLFSFLFFFFETQSHSVTRLECSGTISAHCNL CLPGSSNSPASASQVAGTTGTCHHAQLIFVFLAEMGFHHIGQDGLDLNLVIHPPRSPKALGLQA
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FTO fat mass and obesity associated [ Homo sapiens (human) ]
Official Symbol FTO
Synonyms FTO; ALKBH9; fat mass and obesity associated; alpha-ketoglutarate-dependent dioxygenase FTO; protein fto; AlkB homolog 9; fat mass and obesity-associated protein
Gene ID 79068
mRNA Refseq NM_001080432
Protein Refseq NP_001073901
MIM 610966
UniProt ID Q9C0B1
Chromosome Location 16q12.2
Function DNA-N1-methyladenine dioxygenase activity; ferrous iron binding; oxidative DNA demethylase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FTO Products

Required fields are marked with *

My Review for All FTO Products

Required fields are marked with *

0
cart-icon