Recombinant Human FTSJ1 Protein (1-329 aa), His-tagged
Cat.No. : | FTSJ1-510H |
Product Overview : | Recombinant Human FTSJ1 Protein (1-329 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-329 aa |
Description : | Methylates the 2'-O-ribose of nucleotides at positions 32 and 34 of the tRNA anticodon loop of substrate tRNAs. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | FTSJ1 FtsJ homolog 1 (E. coli) [ Homo sapiens ] |
Official Symbol | FTSJ1 |
Synonyms | FTSJ1; CDLIV; JM23; SPB1; TRM7; MRX9; MRX44; |
Gene ID | 24140 |
mRNA Refseq | NM_012280 |
Protein Refseq | NP_036412 |
MIM | 300499 |
UniProt ID | Q9UET6 |
◆ Recombinant Proteins | ||
FTSJ1-1770Z | Recombinant Zebrafish FTSJ1 | +Inquiry |
FTSJ1-5126HF | Recombinant Full Length Human FTSJ1 Protein, GST-tagged | +Inquiry |
FTSJ1-1759R | Recombinant Rhesus monkey FTSJ1 Protein, His-tagged | +Inquiry |
FTSJ1-4536H | Recombinant Human FTSJ1 Protein, GST-tagged | +Inquiry |
FTSJ1-510H | Recombinant Human FTSJ1 Protein (1-329 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTSJ1-6124HCL | Recombinant Human FTSJ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTSJ1 Products
Required fields are marked with *
My Review for All FTSJ1 Products
Required fields are marked with *