Recombinant Human Full length S100A7 protein(1-101 aa), C-His-tagged
| Cat.No. : | S100A7-2884H |
| Product Overview : | Recombinant Human Full length S100A7 protein(P31151)(1-101 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-101 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
| Gene Name | S100A7 S100 calcium binding protein A7 [ Homo sapiens ] |
| Official Symbol | S100A7 |
| Synonyms | S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1) , S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1; |
| Gene ID | 6278 |
| mRNA Refseq | NM_002963 |
| Protein Refseq | NP_002954 |
| MIM | 600353 |
| UniProt ID | P31151 |
| ◆ Recombinant Proteins | ||
| S100A7-637HFL | Recombinant Full Length Human S100A7 Protein, C-Flag-tagged | +Inquiry |
| S100A7-2491H | Recombinant Human S100A7, GST-tagged | +Inquiry |
| S100A7-431H | Recombinant Human S100 Calcium Binding Protein A7 | +Inquiry |
| S100A7-2884H | Recombinant Human Full length S100A7 protein(1-101 aa), C-His-tagged | +Inquiry |
| S100A7-1212C | Recombinant Cattle S100A7 Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A7-2088HCL | Recombinant Human S100A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A7 Products
Required fields are marked with *
My Review for All S100A7 Products
Required fields are marked with *



