Recombinant Human Full length S100A7 protein(1-101 aa), C-His-tagged
Cat.No. : | S100A7-2884H |
Product Overview : | Recombinant Human Full length S100A7 protein(P31151)(1-101 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-101 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
Gene Name | S100A7 S100 calcium binding protein A7 [ Homo sapiens ] |
Official Symbol | S100A7 |
Synonyms | S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1) , S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1; |
Gene ID | 6278 |
mRNA Refseq | NM_002963 |
Protein Refseq | NP_002954 |
MIM | 600353 |
UniProt ID | P31151 |
◆ Recombinant Proteins | ||
S100A7-431H | Recombinant Human S100 Calcium Binding Protein A7 | +Inquiry |
S100A7-6218H | Recombinant Human S100A7 Protein (Met1-Gln101), N-His tagged | +Inquiry |
S100A7-143B | Recombinant Bovine S100A7 Protein, His/GST-tagged | +Inquiry |
S100A7-185H | Recombinant Human S100A7 protein, GST-tagged | +Inquiry |
S100A7-637HFL | Recombinant Full Length Human S100A7 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
S100A7-3195H | Native Human S100A7 protein(Met1-Gln101) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A7-2088HCL | Recombinant Human S100A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A7 Products
Required fields are marked with *
My Review for All S100A7 Products
Required fields are marked with *