Recombinant Human FUS protein, His&Myc-tagged

Cat.No. : FUS-3533H
Product Overview : Recombinant Human FUS protein(P35637)(1-526aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-526aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 60.9 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Gene Name FUS fused in sarcoma [ Homo sapiens ]
Official Symbol FUS
Synonyms FUS; fused in sarcoma; ALS6, amyotrophic lateral sclerosis 6 , fusion (involved in t(12;16) in malignant liposarcoma) , fusion, derived from t(12;16) malignant liposarcoma; RNA-binding protein FUS; FUS1; heterogeneous nuclear ribonucleoprotein P2; hnRNP P2; TLS; translocated in liposarcoma; oncogene FUS; oncogene TLS; fus-like protein; 75 kDa DNA-pairing protein; fusion gene in myxoid liposarcoma; translocated in liposarcoma protein; ALS6; POMP75; HNRNPP2;
Gene ID 2521
mRNA Refseq NM_001170634
Protein Refseq NP_001164105
MIM 137070
UniProt ID P35637

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUS Products

Required fields are marked with *

My Review for All FUS Products

Required fields are marked with *

0
cart-icon
0
compare icon