Recombinant Human FUT4 Protein, C-His-tagged
Cat.No. : | FUT4-043H |
Product Overview : | Recombinant Human FUT4 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | SSEA-1 antibody detects a lactoseries oligosaccharide antigen that is expressed on the surface of mouse embryonal carcinoma and embryonic stem cells. This antigen is also found on early mouse embryos and both mouse and human germ cells, but is absent on human embryonic stem cells and human embryonic carcinoma cells. Expression of SSEA1 in these human cell types increases upon differentiation, while on the mouse cell types differentiation leads to decreased expression. |
Molecular Mass : | ~39 kDa |
AA Sequence : | GQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | FUT4 fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific) [ Homo sapiens (human) ] |
Official Symbol | FUT4 |
Synonyms | FUT4; fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific); CD15, ELFT, FCT3A; alpha-(1,3)-fucosyltransferase; ELAM ligand fucosyltransferase; FUC TIV; galactoside 3 L fucosyltransferase; Lewis X; fucT-IV; fucosyltransferase IV; ELAM-1 ligand fucosyltransferase; galactoside 3-L-fucosyltransferase; stage-specific embryonic antigen 1; LeX; CD15; ELFT; FCT3A; FUTIV; SSEA-1; FUC-TIV; |
Gene ID | 2526 |
mRNA Refseq | NM_002033 |
Protein Refseq | NP_002024 |
MIM | 104230 |
UniProt ID | P22083 |
◆ Recombinant Proteins | ||
FUT4-4166H | Recombinant Human FUT4 Protein (Gly173-Arg530), C-His tagged | +Inquiry |
FUT4-13044H | Recombinant Human FUT4, His-tagged | +Inquiry |
FUT4-0700H | Recombinant Human FUT4 Protein (Asp264-Thr497), N-His tagged | +Inquiry |
FUT4-6093M | Recombinant Mouse FUT4 Protein | +Inquiry |
FUT4-043H | Recombinant Human FUT4 Protein, C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT4 Products
Required fields are marked with *
My Review for All FUT4 Products
Required fields are marked with *