Recombinant Human FUT4 Protein, C-His-tagged

Cat.No. : FUT4-043H
Product Overview : Recombinant Human FUT4 Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : SSEA-1 antibody detects a lactoseries oligosaccharide antigen that is expressed on the surface of mouse embryonal carcinoma and embryonic stem cells. This antigen is also found on early mouse embryos and both mouse and human germ cells, but is absent on human embryonic stem cells and human embryonic carcinoma cells. Expression of SSEA1 in these human cell types increases upon differentiation, while on the mouse cell types differentiation leads to decreased expression.
Molecular Mass : ~39 kDa
AA Sequence : GQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name FUT4 fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific) [ Homo sapiens (human) ]
Official Symbol FUT4
Synonyms FUT4; fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific); CD15, ELFT, FCT3A; alpha-(1,3)-fucosyltransferase; ELAM ligand fucosyltransferase; FUC TIV; galactoside 3 L fucosyltransferase; Lewis X; fucT-IV; fucosyltransferase IV; ELAM-1 ligand fucosyltransferase; galactoside 3-L-fucosyltransferase; stage-specific embryonic antigen 1; LeX; CD15; ELFT; FCT3A; FUTIV; SSEA-1; FUC-TIV;
Gene ID 2526
mRNA Refseq NM_002033
Protein Refseq NP_002024
MIM 104230
UniProt ID P22083

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT4 Products

Required fields are marked with *

My Review for All FUT4 Products

Required fields are marked with *

0
cart-icon
0
compare icon