Recombinant Human FUT4 Protein, GST-tagged

Cat.No. : FUT4-4563H
Product Overview : Human FUT4 partial ORF ( NP_002024.1, 167 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene transfers fucose to N-acetyllactosamine polysaccharides to generate fucosylated carbohydrate structures. It catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15). [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUT4 fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific) [ Homo sapiens ]
Official Symbol FUT4
Synonyms FUT4; fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific); CD15, ELFT, FCT3A; alpha-(1,3)-fucosyltransferase; ELAM ligand fucosyltransferase; FUC TIV; galactoside 3 L fucosyltransferase; Lewis X; fucT-IV; fucosyltransferase IV; ELAM-1 ligand fucosyltransferase; galactoside 3-L-fucosyltransferase; stage-specific embryonic antigen 1; LeX; CD15; ELFT; FCT3A; FUTIV; SSEA-1; FUC-TIV;
Gene ID 2526
mRNA Refseq NM_002033
Protein Refseq NP_002024
MIM 104230
UniProt ID P22083

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT4 Products

Required fields are marked with *

My Review for All FUT4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon