Recombinant Human FUT4 Protein, GST-tagged
Cat.No. : | FUT4-4563H |
Product Overview : | Human FUT4 partial ORF ( NP_002024.1, 167 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene transfers fucose to N-acetyllactosamine polysaccharides to generate fucosylated carbohydrate structures. It catalyzes the synthesis of the non-sialylated antigen, Lewis x (CD15). [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUT4 fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific) [ Homo sapiens ] |
Official Symbol | FUT4 |
Synonyms | FUT4; fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific); CD15, ELFT, FCT3A; alpha-(1,3)-fucosyltransferase; ELAM ligand fucosyltransferase; FUC TIV; galactoside 3 L fucosyltransferase; Lewis X; fucT-IV; fucosyltransferase IV; ELAM-1 ligand fucosyltransferase; galactoside 3-L-fucosyltransferase; stage-specific embryonic antigen 1; LeX; CD15; ELFT; FCT3A; FUTIV; SSEA-1; FUC-TIV; |
Gene ID | 2526 |
mRNA Refseq | NM_002033 |
Protein Refseq | NP_002024 |
MIM | 104230 |
UniProt ID | P22083 |
◆ Recombinant Proteins | ||
FUT4-4166H | Recombinant Human FUT4 Protein (Gly173-Arg530), C-His tagged | +Inquiry |
FUT4-0700H | Recombinant Human FUT4 Protein (Asp264-Thr497), N-His tagged | +Inquiry |
FUT4-6093M | Recombinant Mouse FUT4 Protein | +Inquiry |
FUT4-13044H | Recombinant Human FUT4, His-tagged | +Inquiry |
FUT4-043H | Recombinant Human FUT4 Protein, C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUT4 Products
Required fields are marked with *
My Review for All FUT4 Products
Required fields are marked with *
0
Inquiry Basket