Recombinant Human FUT8 protein, His-tagged
| Cat.No. : | FUT8-518H |
| Product Overview : | Recombinant Human FUT8 protein(NP_004471)(276-575 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 276-575 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | HWSGEVKDKNVQVVEFPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FUT8 fucosyltransferase 8 (alpha (1,6) fucosyltransferase) [ Homo sapiens ] |
| Official Symbol | FUT8 |
| Synonyms | FUT8; fucosyltransferase 8 (alpha (1,6) fucosyltransferase); alpha-(1,6)-fucosyltransferase; alpha1-6FucT; glycoprotein 6-alpha-L-fucosyltransferase; GDP-fucose--glycoprotein fucosyltransferase; GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase; MGC26465; |
| Gene ID | 2530 |
| mRNA Refseq | NM_004480 |
| Protein Refseq | NP_004471 |
| MIM | 602589 |
| UniProt ID | Q9BYC5 |
| ◆ Recombinant Proteins | ||
| FUT8-31H | Active Recombinant Human FUT8 Protein (AA 41-575), N-6×His/GFP tagged | +Inquiry |
| FUT8-3394M | Recombinant Mouse FUT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FUT8-577H | Active Recombinant Human Fucosyltransferase 8 (alpha (1, 6) fucosyltransferase), His-tagged | +Inquiry |
| FUT8-171HF | Recombinant Full Length Human FUT8 Protein | +Inquiry |
| FUT8-2415R | Recombinant Rat FUT8 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FUT8-497HCL | Recombinant Human FUT8 cell lysate | +Inquiry |
| FUT8-001HCL | Recombinant Hamster FUT8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT8 Products
Required fields are marked with *
My Review for All FUT8 Products
Required fields are marked with *
