Recombinant Human FXR1 protein, His-tagged
| Cat.No. : | FXR1-5363H |
| Product Overview : | Recombinant Human FXR1 protein(P51114)(218-280aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 218-280aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 7.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLE |
| Gene Name | FXR1 fragile X mental retardation, autosomal homolog 1 [ Homo sapiens ] |
| Official Symbol | FXR1 |
| Synonyms | FXR1; fragile X mental retardation, autosomal homolog 1; fragile X mental retardation syndrome-related protein 1; hFXR1p; FXR1P; |
| Gene ID | 8087 |
| mRNA Refseq | NM_001013438 |
| Protein Refseq | NP_001013456 |
| MIM | 600819 |
| UniProt ID | P51114 |
| ◆ Recombinant Proteins | ||
| FXR1-587HF | Recombinant Full Length Human FXR1 Protein, GST-tagged | +Inquiry |
| FXR1-548H | Recombinant Human FXR1 protein, His-tagged | +Inquiry |
| FXR1-5363H | Recombinant Human FXR1 protein, His-tagged | +Inquiry |
| FXR1-547H | Recombinant Human FXR1 protein, His-tagged | +Inquiry |
| FXR1-2075R | Recombinant Rat FXR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXR1-6106HCL | Recombinant Human FXR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXR1 Products
Required fields are marked with *
My Review for All FXR1 Products
Required fields are marked with *
